KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330302
Entry
4330302           CDS       T01015                                 
Name
(RefSeq) lysophospholipid acyltransferase 2
  KO
K13519  lysophospholipid acyltransferase [EC:2.3.1.51 2.3.1.23 2.3.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4330302
   00564 Glycerophospholipid metabolism
    4330302
   00565 Ether lipid metabolism
    4330302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4330302
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     4330302
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     4330302
    2.3.1.-
     4330302
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4330302
SSDB
Motif
Pfam: MBOAT
Other DBs
NCBI-GeneID: 4330302
NCBI-ProteinID: XP_015626464
UniProt: A0A0P0VMV6
LinkDB
Position
2:27559210..27566963
AA seq 459 aa
MGLEMEGMAAAIGVSVPVLRFLLCFAATIPTGLMWRAVPGAAGRHLYAGLTGAALSYLSF
GATSNLLFVVPMAFGYLAMLLCRRLAGLVTFLGAFGFLIACHMYYMSGDAWKEGGIDATG
ALMVLTLKIISCAINYSDGMLKEEGLRDAQKKYRLAKLPSLIEYFGYCLCCGSHFAGPVY
EMKDYLEYTERKGLWASPTPSPLLPTLRALVQAGACMGLYLYLSPQFPLSRFSEPLYYEW
GFWHRLFYQYMSGFTARWKYYFIWSLSEAAIIISGLGFSGWSDSSPPKAKWDRAKNVDVL
GVELATSAVQLPLMWNIQVSTWLRYYVYERLVQKGKKPGFLQLLGTQTVSAVWHGLYPGY
IIFFVQSALMINGSKVIYRWQQAVSNPVFHAILVFVNFSYTLMVLNYSCIGFQVLSFKET
LASYQSVYYIGTIVPIVVVLLGYVIKPARPVKPKARKAE
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggggctggagatggaggggatggcggcggcgatcggcgtgtcggtgcccgtgctccgc
ttcctgctctgcttcgcggccaccatcccgacgggcctcatgtggcgggcggtgcccggc
gccgcggggcggcacctctacgcggggctcaccggcgccgcgctttcctacctctcgttc
ggggccacatccaacctcctcttcgtcgtgcccatggcgttcgggtacctcgccatgctc
ctctgccgccggctcgcggggctcgtcaccttcctcggcgccttcggcttcctcatcgca
tgtcacatgtactacatgagtggagatgcatggaaggagggtggcattgatgcaacaggt
gctttaatggttttaacattgaaaatcatttcatgtgcaataaactacagtgacggtatg
ttgaaggaagagggtttgcgtgatgcccagaaaaagtatcgtttggctaaacttccttct
ttgatcgaatattttggctactgcctctgctgtggcagccattttgctgggccagtatat
gagatgaaagattatcttgaatatactgaacggaaaggattatgggccagcccaactcct
tcaccactattgcctactttgcgtgctctagttcaagctggcgcatgtatggggttatat
ttgtatctatcacctcaatttccactttcacggtttagcgagcccttatattatgagtgg
ggtttctggcaccggctcttctatcagtacatgtcaggctttactgctcgttggaaatac
tactttatatggtcactttcagaagctgcaatcattatatctggtctgggttttagcggc
tggtctgattcatctcccccgaaagccaaatgggatcgtgcaaaaaatgttgatgtttta
ggtgtcgaattagctacaagtgcagttcagttgccgcttatgtggaacattcaagtgagc
acatggctgcgatactatgtttatgagaggttagttcagaaaggaaagaaacctggtttc
ctccagttgctgggtacacagacagtcagtgctgtctggcatggtctttatcccggatat
atcatattctttgttcaatcagcattgatgataaatggttcaaaagtcatatacagatgg
caacaagcagtcagcaatccagtcttccacgctatcctggtttttgtaaatttttcatac
accttgatggtccttaactactcatgtattgggttccaggtactgagcttcaaggaaacc
ctagcatcctaccagagcgtatattatatcggcacaattgttcccattgtagttgtcttg
ctgggttatgttatcaagccagccaggccagtgaagccaaaggctcggaaggcagaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338527
Entry
4338527           CDS       T01015                                 
Name
(RefSeq) lysophospholipid acyltransferase LPEAT1 isoform X1
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4338527
   00565 Ether lipid metabolism
    4338527
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4338527
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     4338527
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     4338527
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4338527
SSDB
Motif
Pfam: Acyltransferase JmjN
Other DBs
NCBI-GeneID: 4338527
NCBI-ProteinID: XP_015640207
UniProt: Q0DIW0 Q5W795
LinkDB
Position
5:complement(16977285..16982280)
AA seq 404 aa
MALPLHDATTSPSDPDDLGGGGEEEEERLASKPLLSSPSTYPSAGTEEGVEELELDRRYA
PYARRDAYGAMGRGPLGAAGAGRLAVGAAVLFPLRLAAGVLVLVAYYLVCRVCTLRVEEE
EREGGGGGAAGEVEGDGYARLEGWRREGVVRCGRALARAMLFVFGFYWIREYDCRFPDAE
DEHQEQSKELGRPGAVVSNHVSYVDILYHMSSSFPSFVAKRSVARLPMVGLISKCLGCIF
VQRESKTSDFKGVSGAVTERIQRAHQQKNSPMMLLFPEGTTTNGDYLLPFKTGAFLAKAP
VKPVILRYPYKRFSPAWDSMSGARHVFLLLCQFVNNLEVIHLPVYYPSEQEKEDPKLYAN
NVRKLMAVEGNLILSDLGLAEKRVYHAALNGNNSLPRALHQKDD
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggctctccctctccacgacgccaccacctccccctccgaccccgacgacctcggcggc
ggcggcgaggaggaggaggagaggctcgcctcgaagccgctgctctcgtccccgtccacc
tatccttccgcggggacggaggagggcgtcgaggagctggagctcgaccggaggtacgcg
ccgtacgcgaggcgggacgcgtacggggcgatgggccggggccccctgggcgcggcgggg
gcggggcggctggcggtgggcgccgccgtgctcttcccgctccggctcgccgcgggcgtg
ctcgtgctcgtcgcctactacctcgtgtgccgcgtgtgcacgctgcgtgtggaggaggag
gagcgcgagggtggcggtggcggcgcggctggagaagtggagggggacgggtacgcgcgg
ctcgaggggtggaggcgtgagggcgtcgtgcggtgcggccgcgcgctcgcgcgcgccatg
ctgttcgtcttcggcttctactggatccgcgagtacgactgccgcttccctgatgctgag
gatgagcatcaggaacagtccaaagaattgggaagaccaggggcagtagtatctaatcat
gtatcttatgtggatattctttaccacatgtcatcttccttcccaagctttgttgccaag
agatcagtggccagattgcccatggttggtctcataagcaaatgtcttggatgcattttt
gttcagcgggaatctaaaacctcagatttcaaaggcgtttcaggtgctgtgactgagaga
atccaacgggctcatcaacagaagaattctccaatgatgctacttttccctgaaggcaca
actacaaatggtgattatctcctccctttcaagacaggagcatttcttgcaaaagcacca
gtgaagccagtcattttaagatatccttacaagagatttagtccagcatgggattcgatg
tctggggctcggcatgtatttctgctcctttgtcaatttgtaaataaccttgaggtgatc
catttgcctgtgtattacccatctgagcaagagaaggaagatcctaagctgtacgcaaat
aatgtacggaaattgatggcagtggaggggaacttgattctttctgatcttgggctagca
gagaagcgtgtgtaccatgcggcattgaatggtaataatagtctacctcgtgctttacat
cagaaagatgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342043
Entry
4342043           CDS       T01015                                 
Name
(RefSeq) lysophospholipid acyltransferase LPEAT2
  KO
K13510  lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4342043
   00565 Ether lipid metabolism
    4342043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:osa01004]
    4342043
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     4342043
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     4342043
Lipid biosynthesis proteins [BR:osa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   4342043
SSDB
Motif
Pfam: Acyltransferase EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 4342043
NCBI-ProteinID: XP_015643209
UniProt: Q0D9K3 Q5Z801
LinkDB
Position
6:30122872..30128018
AA seq 556 aa
MASRNPSPASLSTPLLSDSISPTPTTNGHAGHHNHDDDDEESPTVCGGDGGGGGDPFAFL
SEDRPAWWSPRGVSPADPFRNGTPGWCGAYELVRALVCAPVAAARLVLFGLSIAVGYAAT
WVALRGWVDVRERAAQEGAGPMPAWRRRLMWITRISARCILFSFGYHWIRRKGKPAPREL
APIVVSNHVSYIEPIYFFYELFPTIVSSDSHDSIPFVGTIIRAMQVIYVDRFSPASRKSA
VNEIKRKAACNSFPRVLLFPEGTTTNGRFLISFQHGAFIPGYPVQPVIVRYPHVHFDQSW
GNISLGKLMFKMFTQFHNFMEVEYLPVVYPPEIKQENALHFAENTSYAMAHALNVIPTSY
SYGDSMIMARAVEDGKVNCSNYMVEMAWVKETYGVSTSEAMALLEDFLCMSPDKDGRVNA
QDFWAHFGLNCTPLCKKIFQYFDFEAKESITFRQFLIGCAHLRKQPSFQDACETAFERCR
NPLTSHIGREQLADVLRSSMLELMTDNGMMKLFKTLDVDDDDGISKDDLMASLRKLPFMI
ALFAGRINGEVYIEIV
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggcttctcgaaaccctagccccgcctccctctccacgccgctcctctccgactccatc
tcgcccacgcccaccaccaacggccacgcggggcaccataaccacgacgacgacgacgag
gagtcgccaacggtgtgcggcggcgatggcggaggagggggggacccgttcgcgttccta
tcggaggatcggccggcgtggtggtcgccgcggggggtgtccccggccgacccgttccgc
aacgggacgccggggtggtgcggggcgtacgagctcgtgagggcgctcgtgtgcgcgccg
gtggcggcggcgaggctggtgctgttcgggctctccatcgcggtggggtacgccgccacg
tgggtggcgctccgcgggtgggtcgacgtgcgggagcgggcggcgcaggagggcgccggg
cccatgccggcgtggcgccgccgcctcatgtggatcacgcggatctccgcgcgctgcatc
ctcttctccttcggataccattggataaggaggaaaggaaaacccgcgcctagagagctt
gcacctatagttgtctcaaatcatgtatcatacatagaacccatatacttcttctatgag
ctgttcccgacaatcgtttcttcagattctcatgattccataccatttgttggaacaatt
atccgagcaatgcaggttatatatgttgacagattctcgccagcttcaaggaagtctgct
gtaaatgaaataaagagaaaggcggcttgcaatagcttcccacgtgtcttgttattcccg
gaaggcacgacaacaaatggaagatttctgatttctttccaacatggtgcattcatacct
ggctaccctgttcaacctgttattgtgcgctatccacatgtgcactttgatcaatcatgg
ggaaatatatcattaggaaagctcatgttcaagatgtttacccagtttcacaatttcatg
gaggtagagtacctccctgttgtttacccacctgagatcaagcaagagaatgcccttcat
tttgcagagaacactagctatgctatggcacatgcacttaatgttattccaacctcttat
tcatatggggattcaatgatcatggctcgagcagtggaagatggaaaggtgaactgctca
aattatatggtggagatggcttgggtaaaagaaacatatggtgtgagcacatcagaagca
atggcactcttggaagactttttgtgtatgagcccagacaaggacggacgtgtgaatgcg
caagatttttgggctcattttggccttaattgcacccctctttgcaagaagatatttcag
tacttcgattttgaagccaaggaatccatcacattccgtcagttcttgattggatgtgcg
cacctcaggaagcagccatcgtttcaggacgcctgcgaaaccgcgtttgagaggtgtagg
aatcccctaacatctcacatcggcagggagcagctcgccgatgtcctgcggtcaagcatg
cttgagctgatgaccgataatgggatgatgaagctgttcaagacgttggacgtcgacgat
gacgacggaatcagcaaggatgacctgatggcatcccttaggaagctccccttcatgatc
gcgctcttcgcgggccggatcaacggggaagtctacatcgagatagtttga

DBGET integrated database retrieval system