KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330320
Entry
4330320           CDS       T01015                                 
Name
(RefSeq) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic
  KO
K01770  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC:4.6.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4330320
Enzymes [BR:osa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.12  2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
     4330320
SSDB
Motif
Pfam: YgbB
Other DBs
NCBI-GeneID: 4330320
NCBI-ProteinID: XP_015627624
UniProt: Q6EPN6
LinkDB
Position
2:complement(27773434..27775505)
AA seq 275 aa
MLVSPSPYRKYFGASGARKKTAGFLSIPQPKKPPNKTAKLARSLRAISPRDDAMATASSL
FLASPVATAPTARARSTPSASPARPSLRLRRPSTLAAAAVQAEHQPAVAAAPKPPALPFR
VGHGFDLHRLEPGLPLIIGGIDIPHDRGCDAHSDGDVLLHCVVDAILGALGLPDIGQIFP
DSDPRWKGADSSVFMREAVKLMHEAGYELGNLDATLILQKPKISPFKETIRSNLCDLLGA
DPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK
NT seq 828 nt   +upstreamnt  +downstreamnt
atgctcgtctcgccttcgccttaccgcaaatacttcggggcttccggcgcacgcaaaaaa
accgcaggttttcttagcattccacagccgaaaaagcccccaaacaaaacagccaagctt
gctcggtcgctgcgcgctatctcgcctcgcgacgacgccatggccaccgcctcctcactc
ttcctcgcctcccccgtcgccaccgcgccgacagcccgcgcccggtccacaccctcggct
tcccctgcccggccgtccctgcgcctccggcggccgtcgacgttggccgcggccgcggtc
caggccgagcaccagcccgcggtcgccgcggcgccgaagccgccggcactcccgttccgc
gtcggccacggcttcgacctccaccgcctcgagccgggcctccccctcatcatcgggggc
atcgacatcccccacgaccgcggctgcgacgcccactccgacggggacgtgctgctgcac
tgcgtggtggacgcgattctcggcgcgctcgggctgcctgacatcgggcagatcttcccg
gactccgacccccgttggaagggcgccgattcgtcggtgttcatgagggaagctgtgaaa
ctgatgcatgaagctggctatgagctggggaacctagacgctacattgatcttgcagaaa
cccaaaattagcccattcaaggagacaatacggtctaacttgtgtgacttgctgggggcg
gatccatccgtcgtcaatctgaaggccaagacgcacgagaaagtcgacagtcttggtgaa
aacaggagcatagctgctcacactgtagttcttctgatgcggaaatag

DBGET integrated database retrieval system