KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330370
Entry
4330370           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4330370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4330370
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4330370
  Bacteria
    4330370
  Archaea
    4330370
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-GeneID: 4330370
NCBI-ProteinID: XP_015623578
UniProt: A3AA99 Q6ZGY5
LinkDB
Position
2:complement(28288913..28292083)
AA seq 181 aa
MAAAAAYPTAATLPPRRAPPPSLRPSPPLSWSASIAHLALSPPPVPSNRASLVVRAAWTR
RSRKEAEERPNRKSWKQRTDMYMRPFLLNVFFSKRFVHAKVVHRGTSKVISVASTNAKDL
RTTLPSLVDDNACRTIGRLIAERSMDADVFAMSYEPKKNERIEGKLGIVIDTIKEHGIIF
V
NT seq 546 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgcgtaccccaccgccgccactctccccccgcgccgcgcacctccg
ccctctctccggccgtcgccgccgctctcgtggtccgcctccatcgcccacctcgcgctc
tcgccgccgcccgtgcccagcaaccgcgcgtccctggtggtgcgcgcggcgtggacgcgg
cggtcgcggaaggaggcggaggagaggcccaaccgcaagtcgtggaagcagcgcacggac
atgtacatgcggccgttcctgctcaacgtcttcttctccaagcgcttcgtccacgccaag
gtcgtgcacaggggcaccagcaaggtcatctccgtcgccagcaccaacgccaaggacctc
aggaccacgctgccctccctcgtcgacgacaacgcctgcaggaccatcggccgcctcatc
gccgagaggtccatggacgccgacgtcttcgccatgtcctacgagcccaagaagaacgag
aggatcgaggggaagcttggcatcgtcatcgacaccattaaggagcacggcattatattt
gtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334651
Entry
4334651           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L18, chloroplastic
  KO
K02881  large subunit ribosomal protein L18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334651
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334651
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4334651
  Bacteria
    4334651
  Archaea
    4334651
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-GeneID: 4334651
NCBI-ProteinID: XP_015630413
UniProt: Q8SAY0
LinkDB
Position
3:34785465..34787290
AA seq 170 aa
MLASPALAGARAFAATVSGSLGIPIPAISAPSPSQARRRASLVVVAKVKVSTPQADRIAR
HVRLRKKVSGTTERPRLSVFRSNKHLYAQVIDDTKSCTLVSASTMHKSLSKDLEYSAGPT
VEVAQKIGEVIAKSCLEKGITKVVFDRGGFLYHGRIKALADAARENGLDF
NT seq 513 nt   +upstreamnt  +downstreamnt
atgctcgcctcgccggcgctcgccggcgcgcgcgccttcgcggcgaccgtgtccgggagc
ctcggcatccccattccggccatctccgcgccctcgccctcgcaggcgcggcggcgggcc
tctctcgtcgtcgttgcaaaggtcaaggtgtccactccccaggccgaccgcatcgcccgc
catgtccgcctccgcaagaaggttagtggcaccacggagaggccaagactcagtgttttc
cgctcaaacaaacatttatatgctcaagtgattgacgatacaaagtcatgcactctggtt
tcagcttccacaatgcacaagtctctttcaaaggacttggaatactcggcagggccaaca
gttgaagtggcacaaaagattggtgaagtgattgccaagtcttgcttggagaaaggaatt
accaaagttgtttttgaccggggtggtttcctctaccatggtcgcattaaagctctggct
gatgctgctagagagaatgggcttgatttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348935
Entry
4348935           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4348935
  KO
K02881  large subunit ribosomal protein L18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348935
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4348935
  Bacteria
    4348935
  Archaea
    4348935
SSDB
Motif
Pfam: Ribosomal_L18p
Other DBs
NCBI-GeneID: 4348935
NCBI-ProteinID: XP_015614406
UniProt: B9G6B6 Q337J7
LinkDB
Position
10:complement(18301444..18304765)
AA seq 323 aa
MSLRQLLLQARRFASRPPPPLSNMLVLCRGISDRGHKALPSAPPRHSTGQIQMPQTFHCS
NANPLGNRFQIDVVDSDLWPASFDLSMDHAPKTGCPDDFQEHEDGEMHDSEDEIDDMRHR
KKLFYKLDRGSKEFEENNVSLRHRRKREKGNVKNPKESKKVDPDESASVKLPKLKTKYTV
REEDVVEAKRDRVPTFNQMTDPYHHPFCLDIHVTKGSVRACFVHRVSSRVVTVAHSISKD
MKFDVGSRKGMKACAAVGALLAKRAIEDDIHNAIYTPRKGDRIEGKIEVVLRAIIDNGVE
VKVKLKQRKPTKNALAMQHSQSH
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtcgctccgacagctgcttctccaagcgcggcgcttcgcgtctcggccgccgccgccg
ctctcgaatatgctcgttctctgccgaggcatttctgaccgcggacacaaagccttgcct
tcggcgccgcctcgccactccaccgggcaaatccagatgccgcaaactttccattgctca
aatgccaacccccttggcaatcgcttccaaattgacgtggtcgactccgacctctggccc
gcatccttcgacctgtccatggaccatgcaccgaaaactgggtgccctgatgattttcaa
gaacatgaggatggagaaatgcatgactctgaagatgagatagatgacatgaggcaccgt
aagaagctgttttacaagttggacaggggttccaaggagtttgaggagaacaatgtgtcc
ttgcgccacaggcggaagagagaaaaaggcaatgtaaagaatccaaaggaatccaagaag
gtggatcctgatgaatccgcttctgtgaagctcccaaagctgaaaacgaagtatacagtg
cgtgaggaggatgtggttgaggcaaagagggatcgggtgccaacatttaaccagatgacg
gatccttaccaccaccctttctgtctggacatacatgtcaccaaggggtccgttcgtgct
tgctttgtgcaccgagtgagcagcagggttgtcacagtcgcgcactccatatcaaaggac
atgaagtttgatgtcggttcaaggaaaggtatgaaggcgtgtgcagcggttggggcattg
cttgcaaaacgtgcaatagaggatgatattcacaatgcgatttatacaccaaggaaagga
gataggattgaagggaagattgaggttgtgctgcgtgcaattattgataatggggttgaa
gttaaggtgaaactcaagcaaaggaagccaacaaagaatgcactggctatgcagcattct
caatctcactga

DBGET integrated database retrieval system