KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330380
Entry
4330380           CDS       T01015                                 
Name
(RefSeq) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4330380
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     4330380
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 4330380
NCBI-ProteinID: XP_015627599
UniProt: A0A0P0VN25 Q6ZGS9
LinkDB
Position
2:28362828..28366906
AA seq 443 aa
MASPSLRDAVGGLDRDPFVSLLGKLIGESRRLQNDPPALVPQEDLVAQHVVDALLPVSME
TGGGPLVVRKVSYAEGRSNVIVEYPGTVPGRAISFVGMHMDVVPANPDEWDFDPFSLTFD
SEDKDKLRGRGTTDCLGHVALVAQLMRRLGEVKPVLKHSVIAVFIANEENSLITGIGVDG
LVKDGLLDKLKNGPLFWIDTADKQPCIGTGGVITWHLKAIGKLFHSGLAHKAINAMELNM
EALKEIQTMFYNDFPPHEKEKLYKFATPSTIKPTKWSYPGGGLNQIPGECTISGDIRLTP
FYSTTSVVKKLQEYVHDINENIEKLPTRGPVSKYVLPDENLRGRLEITIDEDIMNGVACN
LESRGFQALCKATEEIVGHVEPYSITGSLPLIRELQDEGFDVQTAGYGLLKTYHAKNEYC
LFSDMAQGFQVFLSIISQLEADV
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggcatcgccgtcgctcagggacgccgtgggcggcctcgaccgcgaccccttcgtctcc
ctcctcgggaagctcatcggcgagtcccgccgcctgcagaacgacccgccggccctcgtc
ccgcaggaggacctcgtggcgcagcacgtggtcgacgcgctcctcccggtgtccatggag
accgggggcggcccgctcgtcgtgcggaaggtgagctacgccgagggccggagcaacgtc
atcgtcgagtaccccggcaccgtccccggccgcgccatctccttcgtcggcatgcacatg
gacgtcgtccccgccaaccccgacgaatgggatttcgatcccttctcactaacgtttgac
agtgaagacaaggacaaacttaggggccgtgggacaaccgactgccttggccatgtggcg
ctggttgctcagctcatgaggagacttggtgaggtcaagccggtgctgaaacattcggtc
attgcggtgttcattgccaatgaggaaaactcacttatcactggcattggtgtcgatggc
cttgtgaaggatgggttgctggataagctcaagaatggacccttgttttggatagatacg
gccgataagcagccttgcatcggcaccggtggagtgattacatggcatctgaaggcaatt
gggaagctattccacagtggcctcgcacataaggccataaatgccatggagttaaatatg
gaagcactgaaagaaatacagactatgttttacaacgatttccctccacatgagaaagag
aagctctataagtttgctaccccatctacgatcaaaccaacaaaatggagctatcctggt
gggggtctgaatcaaattcctggagaatgtacaatttcaggggatataaggttgactcct
ttctacagcacgacatctgtagtgaagaaattacaagagtatgtacatgatataaatgag
aacattgaaaagcttcctactcgtggtccggtatctaaatatgttcttcctgatgaaaac
ctccgaggaaggcttgagatcactattgatgaagatattatgaatggggtggcctgtaat
ctcgagtcgcgaggctttcaagcattatgcaaagcaactgaggaaattgtcggccacgtg
gaaccatattccattactgggagtctgcccctgattagggaattacaggatgaagggttt
gatgttcagactgctgggtatggcttactcaagacataccacgcaaagaacgagtactgt
ctattttcagatatggcccaaggctttcaagtatttctgagcatcatttcacagttggaa
gcagatgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332434
Entry
4332434           CDS       T01015                                 
Name
(RefSeq) arginine biosynthesis bifunctional protein ArgJ, chloroplastic
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4332434
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     4332434
    2.3.1.35  glutamate N-acetyltransferase
     4332434
SSDB
Motif
Pfam: ArgJ PhnG
Other DBs
NCBI-GeneID: 4332434
NCBI-ProteinID: XP_015630479
UniProt: Q10N79
LinkDB
Position
3:complement(9506731..9510932)
AA seq 463 aa
MPPPSLLLLHPRTPLPHHHRSSFRTSSPRPSRMVCAAAEGFISAAPILLPDGPWKQVEGG
VTAAKGFKAAGIYGGLRAKGEKPDLALVACDVDATVAGAFTTNVVAAAPVLYCKRVLNSS
KTARAVLINAGQANAATGDAGYQDTVDSADAVAKLLNVSTNDILIQSTGVIGQRIKKEAL
VNSLHRLVGSLSSSIEGANSAAVAITTTDLVSKSIAVQTEIGGVPIKIGGMAKGSGMIHP
NMATMLGVLTTDAQVSSDVWREMVRTSVSRSFNQITVDGDTSTNDCVIALASGLSGLSSI
LTHDSTEAQQFQACLDAVMQGLAKSIAWDGEGATCLIEVTVAGANNEAEAAKIARSVASS
SLVKAAVFGRDPNWGRIACSVGYSGIQFDADQLDISLGAIPLMKNGQPLPFDRSAASKYL
KDAGDIHGTVNIDVSVGRGGGSGKAWGCDLSYKYVEINAEYTT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgccgcccccttccctcctgctcctccatccacgcacgccgctgccgcaccaccaccgc
tcctccttccggacgagctctccgcggccatccaggatggtctgcgccgctgccgagggg
tttatctccgcggcgccgatcctcctccccgacggcccgtggaagcaggtggaaggcggc
gtcacggcggcgaaggggttcaaggcggcgggtatctacggcggtctgcgcgccaagggc
gagaagcccgaccttgcgctggtcgcctgcgacgtcgacgccactgtcgcgggagctttt
actacgaatgttgttgctgctgcaccagttttgtactgtaagcgtgtccttaattcatca
aaaacagctcgagctgtgttaattaatgctggacaagcaaatgcagcaacaggtgatgca
ggatatcaggatacagtggatagtgctgatgctgttgccaagcttcttaatgtgagcaca
aatgacatactgatccagtccactggtgttattggtcagagaataaagaaggaggcactt
gtaaattcacttcatagacttgtgggctcactgtcttcatccattgagggtgcaaattct
gcagctgtggccattacaactacagaccttgttagcaagagcatcgctgtacagacagag
attggaggagtgcctatcaaaataggaggaatggccaaaggttctgggatgattcatcca
aatatggcaacaatgcttggtgttttaacaactgacgctcaagtcagcagtgatgtttgg
agagaaatggtccgaacatcagtgagtagaagcttcaatcaaataacagtggatggtgat
acgagtaccaatgactgtgttattgctctggctagtgggttatctggtttatccagtatc
cttactcatgatagcactgaagctcaacagttccaagcatgcttagatgctgtaatgcaa
ggtcttgcaaaatccatagcatgggatggtgagggtgcaacatgtctaattgaggttact
gtagctggtgccaataatgaggctgaagcagctaaaattgctcgttcagtggcatcttcc
tccctggttaaagccgctgtatttggaagagacccaaactggggacgtattgcttgttct
gtcggttattcaggcattcagtttgatgcggaccagcttgatatttcccttggagctatt
ccactaatgaaaaatggtcaaccactcccatttgacagatctgcggccagcaagtatctg
aaagatgctggagacatccatggtacagtgaacattgatgtatcagttgggaggggagga
ggaagtggaaaggcctggggctgtgatttaagttataagtatgtcgagataaatgcggaa
tacacgacgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340457
Entry
4340457           CDS       T01015                                 
Name
(RefSeq) aminoacylase-1
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4340457
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4340457
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340457
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     4340457
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M20
   4340457
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4340457
SSDB
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer DUF4867
Other DBs
NCBI-GeneID: 4340457
NCBI-ProteinID: XP_015643477
LinkDB
Position
6:5621921..5625689
AA seq 456 aa
MKLKPHSNLTMPHLRRRHRRRLLAAVVFLLLSAVVARPAAGAFTELESAQIGRFQDYLRI
RTAHPSPDYAGAAAFLLPYAASLGLRAATLHFTPCKSKPLLLLTWPGTDPSLPSLLLNSH
LDSVPAEPEQWLHPPFAAHRDAATGRVYARGAQDDKCLPIQYLEAIRGLRDAGFAPTRTL
HISLVPDEEIGGADGFEKFAQSEEFRDLNVGFMLDEGQASLTDEFRVFYGDRLVWRLIVK
ATGAPGHGSKLFDGAAVENLMDCVETIAGFREAQFGMVKSGKRGPGEVVSVNPVYMKAGT
PSPTGFVMNMQPSEAEVGFDFRLPPTEDVEHIIRRIKEEWAPAHKNLTYKLMQKGPTRDL
AGRPMVTPTNASNPWWSVFEQAIISAGGKLAKPEILSSTTDSRFIRQLGIPALGFSPMTN
TPILLHDNNEFLEDKVFLRGIKVYEHIIRALSSFKG
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaagctgaagccacactccaacctcacgatgcctcatctccggcggcgccaccgccgc
cgcctcctcgctgccgtcgtcttcctcctcctctctgccgtcgtcgcgcgaccagcagca
ggcgccttcaccgagctcgagtccgcccagatcggccgcttccaggactacctccgcatc
cgcaccgcccacccgtccccggactacgccggcgccgccgccttcctcctcccctacgcc
gcctcgctcggcctccgcgccgccacgctccacttcaccccgtgcaagtccaagccgctc
ctcctcctcacgtggccgggcaccgacccctccctcccctccctcctcctcaactcccac
ctcgactccgtcccggcggagcccgagcagtggctccacccgcccttcgccgcccaccgc
gacgccgccacgggccgcgtctacgcccgcggcgcgcaggacgacaagtgcctccccatc
cagtacctcgaggccatccgcggcctccgcgacgccgggttcgcccccacccgcaccctc
cacatctcgctcgtccccgacgaggagatcggcggcgccgacgggttcgagaagttcgcc
cagtcggaggagttccgggacctcaatgtcgggttcatgctcgacgaagggcaggcgtcg
ctgacggatgaatttagggttttctatggggacaggttggtgtggaggctgatcgtgaag
gctaccggcgcacccggccatggctcgaagttgttcgacggcgccgcggtggagaatttg
atggattgcgtggagaccattgccgggttcagggaggcgcaattcgggatggtgaaatcc
gggaagagaggtcccggggaggtggtgtctgtgaatcctgtgtacatgaaggctggcacg
ccgagccccacgggttttgtaatgaatatgcaaccctcagaagcagaagttggttttgat
tttcgacttcctccaactgaagacgtggaacatatcataagaagaatcaaagaggaatgg
gcaccagctcataaaaacttaacctacaagctgatgcagaaaggaccaacacgggatttg
gcaggacgccccatggtcacaccaaccaatgcatcaaatccttggtggtctgtatttgaa
caggctatcatatctgcaggtggaaagctagctaagcctgagattttatcttcaaccacg
gattcacgcttcatcaggcagttgggcattccggcccttgggttttctccgatgacaaac
actcctatattacttcatgacaataatgagtttctggaggataaagtattcctaaggggc
atcaaagtgtatgaacatattattagagcactgagctccttcaaaggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346012
Entry
4346012           CDS       T01015                                 
Name
(RefSeq) aminoacylase-1
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    4346012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4346012
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4346012
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     4346012
Peptidases and inhibitors [BR:osa01002]
 Metallo peptidases
  Family M20
   4346012
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4346012
SSDB
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Other DBs
NCBI-GeneID: 4346012
NCBI-ProteinID: XP_015650710
LinkDB
Position
8:complement(25388385..25392377)
AA seq 457 aa
MASKKSSTQASPMAAAAASLLLGLLLVLPVPAVSSSDAEEAVVSRFREYLRIDTAQPAPD
YAAAVAFLRGQAGAAGLEARTLELVAGKPLLLLRWPGRRPSLPSLLLNSHTDVVPSEPHK
WDHPPFSAALDEASGRIYARGSQDMKCVGMQYLEAIRRLRSAGFIPDRNIYLTFVPDEEI
GGHEGIEAFVASKEFKDMNVGLVLDEGLASPGEEYRVFYGERSPWWLTIKAKGAPGHGAK
LYDGSAMENLMKSVEAIRRFRTSQFDLVKSGAKAEGDVVSVNFAYLKAGTPTPTGFVMNL
QPSEAEIGLDIRLPPSVHTEALEKRLAEEWAPSSRNLTFEFKQKTSVLDNFGKPAVTPAD
SSNVWWALFEEAVKRAGGKLGKPEIFPASTDARYFRVLGIPAFGFSPMTNTPILLHDHNE
FLSKDEYLKGIGIYESIIRTLATLKDSNVDYESRAEL
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggcgagcaagaagagctcgacgcaggcgtctcccatggccgccgccgccgccagcctt
ctcctcggtctcctcctcgtcctccccgtgccagccgtctcgtcgtcggacgcggaggag
gcggtggtctcccggttccgggagtacctccgcatcgacacggcgcagccggcgccggac
tacgccgcggcggtggcgttcctccgggggcaggccggcgccgcggggctcgaggcgcgc
acgctcgagctcgtcgccggcaagcccctgctgctgctccggtggcccgggcggcgcccg
tcgctcccttcgctgctcctcaactcccacaccgacgtcgtgccgtcggagccgcacaag
tgggaccacccgcccttctccgccgccctcgacgaggcatccggccgcatctacgcgcgt
ggctcccaggacatgaagtgcgtggggatgcagtaccttgaagccatccgccgtcttcgt
agtgcaggctttatcccagatcggaatatctatcttacatttgttccagatgaagaaatt
ggtgggcatgagggtatagaagcatttgttgcatcaaaggagttcaaagacatgaatgta
ggtttggttctcgatgaagggcttgcatcacctggggaggagtaccgcgtgttctatggg
gagcgtagtccttggtggcttactattaaagctaaaggagccccagggcatggtgcaaag
ctgtatgatggtagcgcaatggagaatttgatgaagagtgtggaagcaattaggaggttc
agaacatcacagtttgatttggtcaagtccggagcaaaggctgaaggggatgttgtatca
gtgaattttgcatacttgaaggctggcacaccgacaccaacgggttttgtcatgaatcta
caaccatctgaagcagagataggtctagacatccgactccctcctagtgttcatactgag
gctctagagaagcgtcttgctgaagaatgggcaccttcttcacgcaacttgacatttgag
ttcaaacaaaagacctctgtacttgacaactttggcaagccagccgtcacccctgctgat
agctcaaatgtatggtgggctctatttgaagaggctgtgaagagagccggtggcaaactt
ggtaagccggaaatattcccggcctctactgatgctcgttactttcgggtgcttgggata
ccagcatttggtttttctccaatgacaaacacaccgatattgctccatgatcacaatgag
tttctgagcaaagatgagtacctcaaagggattgggatatacgagtctatcatcaggaca
ttggccactcttaaggacagcaatgtcgactacgaatccagggcagagctatga

DBGET integrated database retrieval system