KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330425
Entry
4330425           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L12-1
  KO
K02870  large subunit ribosomal protein L12e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4330425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4330425
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4330425
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Other DBs
NCBI-GeneID: 4330425
NCBI-ProteinID: XP_015627232
UniProt: A3AAF1 Q6Z8E0
LinkDB
Position
2:28772922..28774124
AA seq 166 aa
MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARVMRPR
SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGEVEIPSA
NT seq 501 nt   +upstreamnt  +downstreamnt
atgccgccgaagctcgacccgacccaggtggtggatgtgttcgtccgcgtgaccggcggt
gaggtcggcgcggcgtcgtcgctcgcccccaagatcgggccgctcggtctctccccgaag
aagatcggagaggacatcgccaaggagaccgccaaggactggaagggcctccgcgtcacc
gtgaagctcaccgtccagaaccggcaggccaaggtctccgtcgtcccctccgccgcggcg
ctcgtcatcaaggcgctcaaggagcccgagagggaccgcaagaaggtgaagaacatcaag
cacagcggcaacatcagcctcgacgacgtcatcgagatcgcgagggtcatgaggcccagg
tccatggccaaggagatggccggcaccgtcaaggagatcctcggcacctgcgtcagcgtc
ggctgcaccgtggacggcaaggaccccaaggacctgcagcaggagatctccgacggcgag
gtcgagatcccctcagcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336856
Entry
4336856           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L12
  KO
K02870  large subunit ribosomal protein L12e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336856
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336856
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4336856
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11 SBDS
Other DBs
NCBI-GeneID: 4336856
NCBI-ProteinID: XP_015637137
UniProt: A0A5S6RBU0
LinkDB
Position
4:30180316..30181999
AA seq 166 aa
MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT
VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVIEIARIMRNR
SMAKEMAGTVKEILGTCVSVGCTVDGKDPKDLQQEISDGEVEIPSA
NT seq 501 nt   +upstreamnt  +downstreamnt
atgccgccgaagctcgacccgacgcaggtggtggatgtgttcgtccgcgtgaccggaggc
gaggtgggcgcggcgtcgtcccttgcccccaagatcggccctctcggtctctcccccaag
aagatcggtgaggacatcgccaaggagacggccaaggactggaagggcctccgcgtcacc
gtcaagctcaccgtccagaaccgtcaggcgaaggtgtccgtcgtcccctccgccgcggcg
ctcgtcatcaaggccctcaaggagcccgagcgggacaggaagaaggtcaagaacatcaag
cacagtggtaacatcagcctcgacgacgtcatcgagatcgccaggatcatgaggaacagg
tccatggccaaggagatggccgggaccgtcaaggagatccttgggacctgcgtcagcgtt
gggtgcaccgtcgacggcaaggaccccaaggatctgcagcaggagatctccgatggcgag
gtcgagatcccttcggcttaa

DBGET integrated database retrieval system