KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330430
Entry
4330430           CDS       T01015                                 
Name
(RefSeq) cell division cycle 20.2, cofactor of APC complex
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4330430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4330430
   03036 Chromosome and associated proteins [BR:osa03036]
    4330430
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     4330430
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4330430
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 WD40_like ATPgrasp_ST
Other DBs
NCBI-GeneID: 4330430
NCBI-ProteinID: XP_015622694
UniProt: Q0DYD7 Q6Z8D3
LinkDB
Position
2:28802793..28805779
AA seq 469 aa
MDAGSHSISSEKSHGLAPRPPLQEAGSRPYMPSLSTASRNPSAKCYGDRFIPDRSAMDMD
MAHYLLTEPKKDKENAAASPSKEVYRRLLAEKLLNNRTRILAFRNKPPEPENVSAADTAS
THQAKPAKQRRYIPQSAERTLDAPDLVDDYYLNLLDWGSKNVLSIALGDTVYLWDASSGS
TSELVTVDEDSGPITSVSWAPDGQHVAVGLNSSDIQLWDTSSNRLLRTLRGVHESRVGSL
AWNNNILTTGGMDGNIVNNDVRIRNHVVQTYQGHSQEVCGLKWSGSGQQLASGGNDNLLH
IWDVSMASSVPSAGRNQWLHRLEDHTAAVKALAWCPFQSNLLATGGGGSDRCIKFWNTHT
GACLNSVDTGSQVCALLWNKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLFM
AQSPDGCTVASAAADETLRFWNVFGSPEAPKPAAKASHTGMFNSFNHLR
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggacgcaggctcccactcgatctcgtcggagaagagccacggactcgcgccgcggccg
ccgctccaggaggccggctcccgcccgtacatgccatcgctgagcactgcctcgcgcaac
ccgtcggccaagtgctacggggataggttcataccggacaggtcggcgatggacatggac
atggcgcactacctgctcacggagcccaagaaggacaaggagaacgcggcggcgtccccg
tccaaggaggtgtaccggaggctgctcgccgagaagctgctcaacaaccggacacggatc
ctcgccttccggaacaagccaccggagcccgagaacgtctctgccgcggatactgcttct
acccaccaggccaagccggccaagcagcggcgctacattccccagtctgccgagaggact
ctggatgcaccggacctcgtcgacgattactatctcaacctgctggactggggaagcaag
aacgtgctgtccattgcgctgggcgacacggtgtacctgtgggacgcctcgagcggatcc
acatctgagctcgtgaccgtggacgaggacagcggcccgatcaccagcgtcagctgggct
cctgacggccagcatgtcgccgttggcctcaactcttccgacatccagctctgggacacc
agctccaaccgactgcttagaactctgagaggtgtgcacgaatcaagagtcggttcactc
gcatggaacaacaacatcctgaccactggcggtatggacggcaacatcgtgaacaatgac
gtaagaatcaggaaccatgtcgtgcagacataccaggggcacagccaggaggtgtgcggg
ctcaagtggtctggttcagggcagcagctggccagtggtggcaacgacaaccttcttcac
atttgggatgtgtccatggcatcgtccgtcccatctgcaggccgcaaccagtggctgcac
aggctcgaggatcacacggccgctgtgaaagcgcttgcatggtgcccattccagagcaac
ctgcttgcaactggaggtggtggtagcgaccggtgcatcaagttctggaacacacacacc
ggtgcatgcttgaactctgtcgataccggatcgcaggtgtgcgctcttctatggaacaaa
aatgagagagagcttctgagttcacacggattcacgcagaaccagctgacattgtggaag
tacccgtcgatggttaagatggctgaactcactggccatacttcccgtgtccttttcatg
gctcagagtcctgatggttgcacagtagcatcggctgctgcagatgagaccctgcggttc
tggaatgtgtttggtagtcctgaagcccccaagcctgcagccaaggcttcccacactggg
atgttcaacagcttcaaccatctcagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336870
Entry
4336870           CDS       T01015                                 
Name
(RefSeq) cell division cycle 20.2, cofactor of APC complex isoform X1
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4336870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4336870
   03036 Chromosome and associated proteins [BR:osa03036]
    4336870
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     4336870
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4336870
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 NBCH_WD40 WD40_like YajC
Other DBs
NCBI-GeneID: 4336870
NCBI-ProteinID: XP_015635405
UniProt: Q0JAG9 A0A0N7KJM4
LinkDB
Position
4:30267815..30270708
AA seq 504 aa
MDAGSHSISSEKSSRYVAPRQPLQEAGSRPYMPSLSTASRNPSAKCYGDRFIPDRSAMDM
DMAHYLLTEPRKDKENAAASPAKEAYRKLLAEKILNNRTRILSFRNKPPEPESILTELRA
DAASIQAKPAKQRRYIPQSAERTLDAPELVDDYYLNLLDWGSSNVLSIALGNSVYLWDAT
NSSTSELVTVDEDNGPVTSVSWAPDGRHIAVGLNSSDVQLWDTSSNRLLRTMRGVHDSRV
GSLAWNNNILTTGGMDGKIVNNDVRIRNHVVQTYQGHQQEVCGLKWSGSGQQLASGGNDN
LLHIWDVSMASSMPSAGRTQWLHRLEDHLAAVKALAWCPFQSNLLASGGGGSDRCIKFWN
THTGACLNSIDTGSQVCSLVWNKNERELLSSHGFAQNQLTLWKYPSMVKMAELTGHTSRV
LFTAQVIFCSLYLPFKLTNIALNRLLITCLVVILQSPDGLTVASAAADETLRFWNVFGAP
EAPKTATKGSHTGMFNNSNHIHIR
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggatgcaggttcgcactcgatctcatcggagaagagcagccggtacgtggcgccgcga
cagccactccaggaggccggatccagaccgtacatgccatcgctgagcacggcgtcccgc
aacccgtcagccaagtgctacggtgacaggtttattccggacaggtcggcgatggacatg
gacatggcgcactacctgctgacggagccgaggaaggacaaggagaacgcggcggcgtcc
ccggccaaggaggcgtaccggaagctgctggccgagaagatcctcaacaaccgcaccagg
attctctccttccgcaacaagccgccagagcccgagagcatcctcacggagctccgtgct
gatgcggcttccatccaagccaagccggcgaagcagcgccgatacattcctcagtctgcc
gagaggactctggatgctccagagcttgttgatgattactacctcaacctactggactgg
ggaagcagcaatgtgctatccattgcgctgggcaactcggtgtacctctgggatgccacg
aacagttcaacttctgagcttgttaccgtcgatgaggacaatggccctgtcaccagcgta
agctgggctcctgatggccggcacatcgccgttggtctcaactcctccgatgtccagctc
tgggacaccagctcaaaccgactgctgaggacgatgcgaggcgtgcacgattcgagggtc
ggttcgctggcatggaacaacaacatcctcacaactggtggaatggatggcaagattgtg
aacaatgatgtgaggatcaggaaccatgttgtgcagacataccaggggcatcagcaggag
gtgtgtggcctcaagtggtcaggatcagggcagcagcttgccagtggtggcaatgacaac
ctcctgcacatatgggatgtgtccatggcatcctctatgccgtctgctggccgcacccag
tggttacacaggcttgaggatcacttggctgctgtgaaggctctcgcgtggtgcccattc
cagagcaacctgctggcatctggtggtggtgggagtgaccggtgcatcaagttctggaac
acacataccggcgcatgcctcaactcgatcgacactgggtcacaagtgtgctcgctggtc
tggaacaagaatgagagagagctgctaagctcacatggattcgctcagaatcagctcact
ttgtggaagtacccgtcaatggttaagatggctgaactcactggccatacctctcgtgtc
cttttcacggctcaggttatcttttgctccttgtacctgccgtttaaattgacaaatatt
gctctgaacagattgctgattacttgtcttgtggtaatcttgcagagccctgatggtctc
acagtagcatctgctgcagcagatgagaccctgagattctggaacgtatttggggctcct
gaagcacccaagactgcaaccaagggttcccacactgggatgttcaacaattccaaccac
attcacatccgttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346480
Entry
4346480           CDS       T01015                                 
Name
(RefSeq) cell division cycle 20.2, cofactor of APC complex
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4346480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4346480
   03036 Chromosome and associated proteins [BR:osa03036]
    4346480
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     4346480
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    4346480
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 Ge1_WD40 WD40_like YajC
Other DBs
NCBI-GeneID: 4346480
NCBI-ProteinID: XP_015611482
UniProt: A0A8J8YIG3 B9G290
LinkDB
Position
9:3168153..3172091
AA seq 478 aa
MEAPGSGSVPTAKRRRLVPRPPPVPLEVAGARGPYMPPLCIKSKNPSAKCYGDRFIPDRS
AMDMDMAYFLLTEPKKEKENTDMLSPAEEAYKRLLAEKLLNNRSRILAFRNKPPEPEGIV
QQLLYETLTSSQTKPARKCRHIPQSSERTLDAPGIVDDFYLNILDWGCKNVMSIALGNTL
YLWNSADGSIMDLVTIDEDDGPITSVSWSCDGQWIAVGLNSSDIQLWDTSSNRMLRTLHG
VHQSRVGSLAWNKNILTTGGMDGNIVNNDVRMRSHVVHIYRGHEDEVCGLRWSGSGQQLA
SGGNDNLVHIWDVSMASSNLSLGHNRWLHRFGDHLAAVKALAWCPFQSNLLASGGGGDDR
CIRFWNTHTGLCLNSVDTGSQVCGLLWNKNEKELLSAHGYVQNSLALWKYPSMVKLAELE
DHTARVLCLAQSPDGFTVASVAADETLRLWKIFETSEDAKPVFKTVNTGMFNSFSHIR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggaggcgccgggctccggctcggtcccaacggcgaagcgccgccggctcgtgccacgg
cctccgccggtgccgcttgaggtggccggcgcgagggggccgtacatgccgccgctatgt
attaaatccaagaacccgtccgcgaaatgctacggtgacagattcatacctgataggtca
gcaatggacatggatatggcatatttcctcctgacagaacctaagaaggagaaggaaaat
actgacatgctatcaccagctgaagaagcttacaagaggcttcttgccgagaaactcctg
aacaacagaagccggattcttgcattcaggaacaaaccaccagaacctgaaggaattgtg
caacagctattatatgaaactttgacttccagtcagacaaagcctgctaggaagtgtaga
cacataccccagtcttctgagaggacgttagatgcccctgggattgttgatgacttctat
cttaacatattggactggggatgcaaaaatgtgatgtccattgcgcttgggaacaccttg
tacctctggaattcagctgatggatctattatggaccttgtaacaattgacgaagatgat
ggtcccatcactagtgttagctggtcttgtgatgggcagtggattgccgttggcctcaac
tcttctgacattcagctgtgggacaccagctctaatcgcatgctgagaacacttcatggt
gtacaccaatcaagggttggttcactggcctggaacaagaacatactgacaactggtgga
atggatggaaacattgtaaacaatgatgtcaggatgagatcccatgttgttcatatatat
cgagggcatgaggatgaggtatgtgggttgagatggtcaggaagtggccagcaattggca
agtggtggcaacgacaacctggtgcacatatgggatgtatcaatggcatcttctaatcta
tctctaggtcataaccggtggcttcatagatttggcgatcatttagctgcagtgaaggcc
cttgcatggtgtccgttccagagcaatttgcttgcatctggtggtggtggagatgatcgg
tgcatcaggttttggaatacacacactggtttatgtttgaattctgttgatactggatca
caggtgtgcggactactctggaataagaatgaaaaggagctgctaagtgctcacggatat
gtacagaattcacttgcattgtggaaatacccttcaatggttaaattggcagaacttgaa
gaccacactgctcgtgttctttgcctggctcagagccctgatggatttacagtagcctct
gttgcagcagatgagactctaaggttatggaaaatttttgaaacttctgaagatgccaaa
cccgtattcaagacagtaaacactggaatgtttaacagtttcagccatatcagatga

DBGET integrated database retrieval system