KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330437
Entry
4330437           CDS       T01015                                 
Name
(RefSeq) probable tocopherol O-methyltransferase, chloroplastic
  KO
K05928  tocopherol O-methyltransferase [EC:2.1.1.95]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00112  Tocopherol/tocotorienol biosynthesis, homogentisate + phytyl/geranylgeranyl-PP => tocopherol/tocotorienol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4330437
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.95  tocopherol C-methyltransferase
     4330437
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 CMAS Methyltransf_12 Ubie_methyltran Methyltransf_32 Methyltransf_20 MetW Methyltransf_24 MTS LCE Methyltransf_2 FtsJ NAS
Other DBs
NCBI-GeneID: 4330437
NCBI-ProteinID: XP_015623086
UniProt: Q6ZIK0
LinkDB
Position
2:28893963..28897435
AA seq 362 aa
MAHAAAATGALAPLHPLLRCTSRHLCASASPRAGLCLHHHRRRRRSSRRTKLAVRAMAPT
LSSSSTAAAAPPGLKEGIAGLYDESSGVWESIWGEHMHHGFYDAGEAASMSDHRRAQIRM
IEESLAFAAVPDDAEKKPKSVVDVGCGIGGSSRYLANKYGAQCYGITLSPVQAERGNALA
AEQGLSDKVSFQVGDALEQPFPDGQFDLVWSMESGEHMPDKRQFVSELARVAAPGARIII
VTWCHRNLEPSEESLKPDELNLLKRICDAYYLPDWCSPSDYVKIAESLSLEDIRTADWSE
NVAPFWPAVIKSALTWKGLTSLLRSGWKTIRGAMVMPLMIEGYKKGLIKFTIITCRKPET
TQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcccacgccgccgcggccacgggcgcactggcaccgctgcatccactgctccgctgc
acgagccgtcatctctgcgcctcggcttcccctcgcgccggcctctgcctccaccaccac
cgccgccgccgccgcagcagccggaggacgaaactcgccgtgcgcgcgatggcaccgacg
ttgtcctcgtcgtcgacggcggcggcagctcccccggggctgaaggagggcatcgcgggg
ctctacgacgagtcgtccggcgtgtgggagagcatctggggcgagcacatgcaccacggc
ttctacgacgccggcgaggccgcctccatgtccgaccaccgccgcgcccagatccgcatg
atcgaggaatccctcgccttcgccgccgtccccgatgatgcggagaagaaacccaaaagt
gtagttgatgttggctgtggcattggtggtagctcaagatacttggcgaacaaatacgga
gcgcaatgctacggcatcacgttgagtccggtgcaggctgaaagaggaaatgccctcgcg
gcagagcaagggttatcagacaaggtctcctttcaagttggtgatgcattggagcagcct
tttcctgatgggcagtttgatcttgtctggtccatggagagtggcgagcacatgccagac
aaacggcagtttgtaagcgagctggcacgcgtcgcagctcctggggcgagaataatcatt
gtgacctggtgccataggaacctcgagccatccgaagagtccctgaaacctgatgagctg
aatctcctgaaaaggatatgcgatgcatattatctcccagactggtgctctccttctgat
tatgtcaaaattgccgagtcactgtctcttgaggatataaggacagctgattggtcagag
aacgtcgccccattctggcctgcggttataaaatcagcattgacatggaaaggtttaact
tctctgctaagaagtgggtggaagacgataagaggtgcaatggtgatgcctctgatgatc
gaaggatacaagaaagggctcatcaaattcaccatcatcacctgtcgcaagcccgaaaca
acgcagtag

DBGET integrated database retrieval system