KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330439
Entry
4330439           CDS       T01015                                 
Name
(RefSeq) 3-dehydrosphinganine reductase TSC10A
  KO
K04708  3-dehydrosphinganine reductase [EC:1.1.1.102]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4330439
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.102  3-dehydrosphinganine reductase
     4330439
SSDB
Motif
Pfam: adh_short adh_short_C2 KR GDP_Man_Dehyd Epimerase NAD_binding_10 Eno-Rase_NADH_b PALP Polysacc_synt_2 Glyco_trans_4_4 THF_DHG_CYH_C RmlD_sub_bind NmrA ADH_zinc_N DFP LDcluster4 3HCDH_N 3Beta_HSD
Other DBs
NCBI-GeneID: 4330439
NCBI-ProteinID: XP_015626612
UniProt: A0A0P0VNI6 Q6ZHJ6
LinkDB
Position
2:28914705..28916891
AA seq 327 aa
MAAALLSLLILVPPIGLLAALAFLARPRAARIPLKGRHVLITGGSSGIGLAMATAAAREG
ARVSILARNAARLEEARGAIRAATGRDVGVHAADVRDADAVARALAEAGPVDVLVCNHGV
FVPQELEKQEMEEVKWMVDINLMGTFHLVKAALPAMKERTKETRLPASIAIMSSQAGQVG
VYGYTAYSASKFALRGLGEALQHEVIADNIHVSLIFPPDTETPGFAEENKRRPELTNIIA
GSSGGMKADDVARKALDGIKSGKFIVPCNFEGAMLAVATAGLSPQSSPLTAFLEIIGAGV
MRFAAICFQFNWFMTIENWYAKNKKHA
NT seq 984 nt   +upstreamnt  +downstreamnt
atggccgccgcgctcctctcgctcctcatcctggtgccgcccatcgggctcctcgcggcg
ctagcgttcctggcgcggcctagggcggcgcggatcccgctcaagggccggcacgtgctc
atcaccggggggtccagcggcatcgggctcgccatggccacggcggcggcgagggagggg
gcgcgggtgtccatcctggcccggaacgccgcaaggctggaggaggcgcgcggcgccatc
cgggccgccacggggcgggacgtcggggtccacgccgccgacgtgcgggacgccgacgcc
gtggcgcgcgcgctcgccgaggcgggccccgtcgacgtcctcgtctgcaaccacggcgtg
ttcgtcccgcaggagctggagaagcaggagatggaggaggtcaagtggatggtggacatc
aacctcatgggcaccttccacctcgtcaaggcggcgctccccgccatgaaggaacgcaca
aaggagacgcgcctcccggcgtccatcgccatcatgtcctcacaggccggccaggttgga
gtttatgggtacaccgcttactcagcgagcaaatttgcgcttcgtggattgggtgaggcc
ttgcagcatgaggttattgcggacaacattcatgtctcgttgatcttccctcctgacaca
gagacaccgggtttcgctgaagagaataaaaggaggccagagttgaccaatatcatagca
ggatcatctggtggcatgaaagctgatgatgttgctaggaaggctttagatggcatcaaa
tccggaaagtttattgtaccctgcaatttcgagggagcaatgttagctgtagctactgct
ggtctatccccacagagttccccgctaacagcattcctggagattattggtgctggagtc
atgcgatttgcagcaatttgcttccaatttaattggttcatgaccatcgagaactggtat
gccaagaacaagaagcatgcgtga

DBGET integrated database retrieval system