KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330505
Entry
4330505           CDS       T01015                                 
Name
(RefSeq) thioredoxin reductase NTRB
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4330505
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     4330505
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox NAD_binding_7 FAD_oxidored NAD_binding_8 Lys_Orn_oxgnase FAD_binding_3 Thi4 NAD_binding_9
Other DBs
NCBI-GeneID: 4330505
NCBI-ProteinID: XP_015627135
UniProt: Q6ZFU6
LinkDB
Position
2:29550953..29554214
AA seq 331 aa
MEGSAGAPLRTRVCIIGSGPSAHTAAIYAARAELKPVLFEGWLANDIAAGGQLTTTTDVE
NFPGFPEGILGGELMDRCRAQSLRFGTSIISETVTAVDFSARPFRVASDSTTVLADAVVV
ATGAVARRLHFAGSDAYWNRGISACAVCDGAAPIFRNKPIAVIGGGDSAMEESNFLTKYG
SHVYIIHRRNTFRASKIMQARALSNPKIQVFWDSEVVEAYGGEGGGPLAGVKVKNLVTGK
ISDLQVSGLFFAIGHEPATKFLGGQLELDADGYVATKPGSTHTSVKGVFAAGDVQDKKYR
QAITAAGSGCMAALDAEHYLQEVGAQEGKAD
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagggatccgccggggcgccgctccgcacgcgcgtgtgcatcatcgggagcgggccg
tcggcgcacacggcggcgatctacgccgcccgcgcggagctcaagcccgtgctcttcgag
ggctggctcgccaacgacatcgcggcggggggccagctcaccaccaccaccgacgtcgag
aacttcccggggttccccgaggggatcctcggcggcgagctcatggatcggtgccgcgcc
cagtccctccggttcggcaccagcatcatctccgagaccgtcaccgcggtcgacttctcc
gcccgccccttccgcgtcgcctccgactccaccaccgtgctcgccgacgccgtcgtcgtc
gccaccggcgccgtcgcccggcgactccacttcgccggctccgacgcctactggaaccgc
ggcatctccgcctgcgccgtctgcgacggggccgccccaatcttcaggaacaaacccatc
gccgtcatcggcggcggcgactccgccatggaggagtccaacttcctcaccaagtacggc
tcccatgtgtacatcatccaccgccgcaacaccttccgcgcctccaagatcatgcaggcc
agggcgttgtcaaaccccaagatccaggttttctgggactctgaggtcgtcgaggcctac
ggcggcgagggtggaggtccattggctggtgtcaaggtgaagaacttggttactgggaag
atctccgaccttcaggtgtccggtctcttcttcgccatcggacatgaaccggcgacgaag
tttctcggcgggcagcttgagctcgatgctgatgggtatgtggccaccaagccaggctcc
acgcacaccagtgtgaagggggtctttgctgctggggatgtgcaggacaagaagtatcgc
caggctattactgccgctggatcagggtgcatggctgctttggacgcggagcactatctg
caggaggtcggtgcacaggagggcaaggccgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340912
Entry
4340912           CDS       T01015                                 
Name
(RefSeq) thioredoxin reductase NTRA
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4340912
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     4340912
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox NAD_binding_7 DAO FAD_binding_3 Thi4 NAD_binding_8 FAD_oxidored Lys_Orn_oxgnase
Other DBs
NCBI-GeneID: 4340912
NCBI-ProteinID: XP_015644379
UniProt: Q69PS6
LinkDB
Position
6:complement(12848655..12852974)
AA seq 368 aa
MRLCSKLAALLRRSRQFAPAAAAASGSATAAAASANGMEEAAAGPLRARVCIIGSGPAAH
TAAVYAARAELKPVLFEGFLANDIAAGGQLTTTTDVENFPGFPDGILGADLMDRCRAQSV
RFGTRILTETVTAVDLSSRPFRVASGDTVVHADAVVVATGAVARRLHFAGSDAFWNRGIS
ACAVCDGAAPIFRNKPIAVVGGGDSAMEEANFLTKYGSRVYIIHRRNAFRASKIMQARAL
SNPKIQVVWDSEVVEAYGGADGGPLAGVKVKNVVSGEVSDLQVAGLFFAIGHEPATKFLG
GQLELDSDGYVVTKPGSTHTSVKGVFAAGDVQDKKYRQAITAAGSGCMAALDAEHYLQEI
GAQEDKTD
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgcgcctctgctccaagctcgcggcgctgctccggaggtcccgccagttcgcgcccgca
gccgccgccgcgtccgggtcagcgacggccgcggccgcgtcggcgaacgggatggaggag
gcggccgcgggcccgctgcgggcgcgcgtgtgcatcatcgggagcgggccggcggcgcac
acggcggcggtctacgcggcgcgcgccgagctcaagcccgtgctcttcgagggcttcctc
gccaacgacatcgccgcgggggggcagctcaccaccaccaccgacgtcgagaacttcccg
ggcttccccgacggcatcctcggcgccgacctcatggaccgctgccgcgcccagtccgtg
cgcttcgggaccaggatcctcaccgagaccgtcaccgccgtcgacctctcgtcccgcccc
ttccgcgtcgcctccggcgacaccgtcgtgcacgccgacgcggtcgtcgtggccacgggc
gccgtcgcgcgccgcctccatttcgccggctccgacgcattctggaaccgcggcatctcc
gcctgcgccgtctgcgacggcgccgcgcccatcttccggaacaagcccattgccgtcgtc
ggcggcggggactccgccatggaggaggccaacttcctcaccaagtacggctcccgcgtc
tacatcatccaccgccgcaacgccttccgcgcgtccaagatcatgcaggcccgggccctc
tccaaccccaagatccaggtcgtctgggactccgaggtcgtcgaggcgtacggcggcgcc
gacggcggtccgttggccggcgtcaaggtcaagaacgtggtgagcggcgaggtctccgac
ctccaggtcgccgggctcttcttcgccattggacacgagccggcgacaaagtttctcggc
gggcagctcgagctggactccgatggctatgtcgtgaccaagcccggctccactcacacc
agcgtcaagggagtcttcgccgccggtgatgttcaggacaagaagtatcgccaggccatt
actgccgcgggatcaggttgcatggcggcgttggatgcggagcactacctacaggagatt
ggagcacaggaagacaagactgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344159
Entry
4344159           CDS       T01015                                 
Name
(RefSeq) thioredoxin reductase NTRC
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    4344159
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     4344159
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin FAD_oxidored Glutaredoxin GIDA Thioredoxin_2 HI0933_like DAO FAD_binding_2 NAD_binding_8 Thi4 Glrx-like Thioredoxin_3 Thioredoxin_4 Thioredoxin_5 OST3_OST6 Trp_halogenase
Other DBs
NCBI-GeneID: 4344159
NCBI-ProteinID: XP_015646853
UniProt: Q70G58
LinkDB
Position
7:27694594..27699165
AA seq 515 aa
MAVTRLAVAAALSAAPPSSRRRRAFFHHSCRPLPSSAAAAAKALRASAAPAVDEEAPASP
PPSDLGKGVENLVIIGSGPAGYTAAIYAARANLKPVVFEGYQVGGVPGGQLMTTTEVENF
PGFPDGVTGPDLMDKMRKQAERWGAELHQEDVEFVNVKSRPFVIRSSDREVKCHSVIIAT
GAAAKRLRLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKYARH
VHLLVRKDQLRASKAMQDRVLNNPNITVHFNTEAVDVVSNPKGQMSGIQLKRTDTGEESV
LEVKGLFYGIGHTPNSQLLQGQIDLDDAGYILVEEGTAKTSVDGVFAAGDVQDHEWRQAV
TAAGSGCVAALSVERYLVANDLLVEFHQPVREEKEKEITDRDVEMGFDISHTKHRGQYAL
RKVYHESPRLVCVLYTSPTCGPCRTLKPILSKVIDEYNEHVHFVEIDIEEDPEIAEAAGI
MGTPCVQFFKNKEMLRTVSGVKMKKEYREFIESNK
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcggtcacgcgcctcgccgtggccgccgccctctcggccgcgccgccgtcctcccgc
cgccgcagggccttcttccatcactcctgccgcccgctcccttcgtcggcggcggcggcg
gccaaggcgttgcgcgcgtcggctgcccccgccgtcgacgaggaggcccccgcatccccg
cctccatcagatcttggcaagggagtggagaacttggtgatcataggctctggcccggcg
gggtacactgccgcgatttacgccgctcgggcgaacctcaagcccgtcgtgttcgaaggc
taccaggttggtggcgttcctggtgggcagctgatgaccaccaccgaggtggagaatttc
cctgggtttccggatggcgtcactgggcctgatctcatggacaaaatgcggaagcaagcg
gagcggtggggtgctgagcttcaccaggaggatgttgagtttgtgaatgtgaagagcaga
ccgtttgttattcgtagcagtgatcgtgaggtgaaatgccatagtgtaatcattgctact
ggtgctgctgctaagcgccttcgattacctcgtgaagatgaattttggagtagaggtatc
agtgcatgtgcaatatgtgatggagcatccccactatttaagggtcaagttcttgcagtt
gttggaggtggtgatacagctacagaggaagctatatatttgaccaaatatgcacgtcac
gttcatttacttgttcgaaaggatcagctacgagcatccaaagctatgcaggaccgagta
ctcaacaatcccaacataacagtacatttcaatacagaagctgtggatgttgtcagcaat
cccaaaggccagatgtctggtattcaactgaagagaaccgacacgggagaggaatcagtt
cttgaggtgaaaggtctattctatggcataggacacactccaaacagtcagttgttacaa
ggtcaaattgatcttgacgatgctggttatattttggttgaagaaggcacagcaaaaaca
tcagttgatggtgtatttgctgctggtgatgtgcaggatcatgaatggaggcaagccgtt
actgcagctggatccggatgtgtagccgctttgtcggtggaaagatacttagttgccaac
gaccttcttgttgaatttcaccagcctgttcgcgaagaaaaggagaaggagattacagat
agagatgtcgagatgggctttgacatttctcacacaaagcataggggacagtatgcactc
cgcaaagtatatcatgaaagtccaaggcttgtctgtgttctatatacttctccaacatgt
ggtccttgcagaaccttaaagccaattctaagcaaggttatagatgagtacaacgaacac
gttcattttgtcgaaattgacatcgaggaggatcctgaaatagcagaagctgcaggcatc
atgggaacaccatgtgttcaattttttaaaaataaagaaatgctcaggactgtctctggt
gttaaaatgaagaaggaatatagggagtttatcgagtcaaacaaatga

DBGET integrated database retrieval system