KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330511
Entry
4330511           CDS       T01015                                 
Name
(RefSeq) diacylglycerol O-acyltransferase 2
  KO
K22848  diacylglycerol O-acyltransferase 2, plant [EC:2.3.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4330511
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     4330511
SSDB
Motif
Pfam: DAGAT Acyltransferase
Other DBs
NCBI-GeneID: 4330511
NCBI-ProteinID: XP_015626299
UniProt: Q6ZFU0 A3AAN8
LinkDB
Position
2:complement(29597928..29601855)
AA seq 338 aa
MGAGNGEVRYGGGGAGAGEAAVMADDGTTVFRGTAQPPVRTTVALALWLGAIHFNAFLLL
ASLFLFPRRVAAMVLATQLFFMFAPVNDMSRLGRKIARFISKCVIGYFPVTLHVEDYKAF
DPNRAYVFGYEPHSVLPIALGVLLELVGFMPLPKIKVLASSAVFYTPFLRQIWTWLGLVP
ASRKNFYSYLKAGYSCVIVPGGVQEMLHMDHDSEVAFLKSRKGFVKIAMETGSPLVPVFA
FGQSYVYKWWRPGGKLIVKIARAIKFTPIMFWGKFGTPIPFATPMHVVVGRPIEVKKNAQ
PTFDEINEVHEQFVVALQELFEKYKTKAGYPNLHLRVL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgggggcggggaatggtgaagtgcggtacggcggcggcggtgccggcgccggcgaggcg
gcggtgatggcggacgacgggaccacggtgttccgggggacggcgcagccgccggtgcgc
accacggttgcgctggcgctgtggctgggggccatccacttcaacgccttcctcctcctc
gcctcgctcttcctcttcccccgccgcgtcgccgccatggtgctcgccacgcagctcttc
ttcatgttcgcgccggtcaatgatatgagcaggttggggcgcaagatcgccaggttcatc
agcaagtgcgtgattgggtacttccccgtcacattacatgtcgaggactacaaggctttt
gatcccaatagagcttacgtgtttggttatgagccgcattctgttttgcccattgccctt
ggggtccttttggagcttgttggattcatgccattaccaaagataaaggttcttgcaagc
agtgcggtgttctataccccattcttgaggcaaatatggacatggttggggttggttcct
gcatccaggaagaatttctactcctaccttaaagctggttatagctgcgtcatagtgcca
ggaggggtgcaggagatgcttcacatggatcatgattcagaggttgcttttcttaaatca
agaaaaggtttcgttaagatagctatggaaacaggttcccctttagtccctgttttcgct
ttcggacagagctatgtttataagtggtggagaccaggtggcaaattaattgtcaaaatt
gctagagcaattaaatttactccaattatgttctggggaaaatttgggactcccattccg
tttgcgacacccatgcacgtggttgttggaagaccaattgaggttaagaaaaatgctcag
cctacctttgatgagataaatgaagtccatgaacaatttgttgtcgcactacaagaactg
ttcgagaagtacaagactaaagctggatatcccaacctccatttaagagttctatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337743
Entry
4337743           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4337743
  KO
K22849  diacylglycerol O-acyltransferase 3, plant [EC:2.3.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4337743
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     4337743
SSDB
Motif
Pfam: DUF4692 2Fe-2S_thioredx DUF6474 DUF1635 FAM60A
Other DBs
NCBI-GeneID: 4337743
NCBI-ProteinID: XP_015639415
UniProt: Q0DKX4 Q75L36
LinkDB
Position
5:2172210..2174211
AA seq 409 aa
MELTGAAIRGSLATAASPVVLRGRGRRCAARVSCVGRGGGGFGDEGHLRYYEAPPRKAVE
AVARDLAKLRPMGIAAGDAAKEKVLSEATELLLEELNRMRDEEGELKKKMKEDKDAMKAL
KKQQKEAMKAATTMKCNDDDSSESSESSESECEEQMMTMSCVATVTMPQIGEGVAISTTV
PQVAASDVATAPAMEYDKAAMKAMKKREKEEKKAAKMAMKMKKKEKKMATLTLCKDEDST
SCSSESSDSECEEVVRMSCCATITTPQTQPSSTVFPIILPQIPESVTLEPCQDAQISSEP
ANTMLSTTATIAVVEKPMTNRIEVCMGGKCKKSGSLAVLQEFEKKVGTDGAVVGCKCLGK
CGLGPNVRLRSEGAAQKKNPLFIGVVLEDVGTIASGLFGGGDDLGMVNN
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggagctcaccggcgccgccatccgggggtcgctggcgacggccgcgtccccggtggtg
ctgagggggagggggaggaggtgcgcggccagggtttcctgcgtcgggcgcggaggcggg
ggatttggcgatgaggggcacctcaggtactacgaggcgccgccgcggaaggcggtggag
gcggtggcgagggacctggccaagctccgccccatggggatcgccgccggggacgcggcc
aaggagaaggtcctctcggaagccacagagctactgctggaggagttgaatcgaatgagg
gatgaggagggcgaactgaagaagaagatgaaggaggacaaggatgcaatgaaagcactc
aagaagcagcagaaggaagcaatgaaggctgccacgacgatgaaatgcaatgatgatgac
tcctctgaatcaagtgaatcaagtgagagtgagtgtgaggagcagatgatgacaatgagc
tgcgttgccactgttaccatgccgcaaattggggaaggcgttgcgatctcaacgacagtt
ccccaagttgctgcatccgatgtcgcaacagcaccagcaatggagtatgacaaggctgca
atgaaggccatgaagaagagagaaaaggaagagaagaaagccgcaaagatggctatgaag
atgaagaagaaggaaaagaagatggccacattgactctctgcaaggatgaagacagcacc
tcatgctcctcagaatctagcgacagcgagtgcgaggaggttgtcagaatgagctgctgt
gctacgataaccacaccacaaacacaaccctcgagcaccgttttccctataatactgccc
cagattccagaatcagtgacactggagccatgccaagatgctcagatctcatcagaacct
gcaaatacaatgttgtccaccactgctaccattgcagtagttgagaagccgatgacgaac
agaattgaggtctgcatgggaggcaaatgcaagaaatcgggctccctcgcggtgctgcag
gagttcgagaagaaggtgggcactgatggtgcggtcgttggctgcaaatgcctggggaaa
tgcggtctaggcccgaatgtgcggctccggagcgaaggcgctgcacagaagaagaatccc
ctcttcatcggagtagtgttagaggatgttggcaccatagcttcaggcttgtttggaggc
ggtgatgacctgggcatggtgaacaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338045
Entry
4338045           CDS       T01015                                 
Name
(RefSeq) diacylglycerol O-acyltransferase 1 isoform X1
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4338045
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     4338045
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     4338045
    2.3.1.76  retinol O-fatty-acyltransferase
     4338045
SSDB
Motif
Pfam: MBOAT MBOAT_2
Other DBs
NCBI-GeneID: 4338045
NCBI-ProteinID: XP_015639406
UniProt: Q5I396
LinkDB
Position
5:5971776..5978617
AA seq 538 aa
MVGSDGDGDGGGGEAHAPAAPAHHHRRPPRPRGGSGAIVEGFAAALRRRIRSGAAAAARA
SFGGDSGDEAASGEPSSSSSSSPSRRRGGDSNGAEASSAAGGGGGRGGGGDFSAFTFRAA
APVHRKAKESPLSSDAIFKQSHAGLFNLCIVVLVAVNSRLIIENLMKYGLLIRAGFWFND
KSLRDWPLLMCCLSLPAFPLGAFAVEKLAFNNVITDAVATCLHIFLSTTEIVYPVLVILK
CDSAVLSGFLLIFIACIVWLKLVSFAHTNHDIRQLTMGGKKVDNELSTVDMDNLQPPTLG
NLIYFMMAPTLCYQPSYPRTSCVRKGWLIRQIILYLIFTGLQGFIIEQYINPIVVNSQHP
LKGGLLNAVETVLKLSLPNVYLWLCMFYAFFHLWLSILAEILRFGDREFYKDWWNAKTID
EYWRKWNMPVHKWVVRHIYFPCMRNGISKEVAVLISFLVSAVLHEICVAVPCRILKFWAF
LGIMLQIPLIVLTAYLKSKFRDTMVGNMIFWFFFCIYGQPMCLLLYYHDVMNRIEKAR
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggtgggctccgatggcgacggcgacggcggcggaggggaagcacacgcgccggcggcg
cccgcgcaccaccaccgccggcccccgcgcccgcggggaggcagcggggccatcgtcgag
ggcttcgcggcggcgctccgtcgcaggatccgctcgggggccgcggcggccgcgcgggcc
agcttcgggggcgactccggggacgaggccgcctccggggagccctcctcgtcctcgtcc
tcgtccccgtcccgccgccgtggcggcgactccaacggggcggaggcgtcctccgccgcc
gggggcggtggtggccgtggcggcggtggggacttctccgcgttcacgttccgcgcggcg
gcgccggtgcaccgcaaggccaaggagagccccctcagctccgacgccatcttcaagcag
agtcatgcaggccttttcaacctatgcattgttgttctagttgcagtgaacagcaggctt
attatcgagaacttaatgaagtatggcttattaataagagctgggttttggtttaatgat
aaatcattgcgggactggccacttctaatgtgttgtcttagtctgcctgctttccccctg
ggtgcatttgcagttgaaaagttggcatttaacaatgttattactgatgctgttgctacc
tgcctccatatcttcctttcaacaaccgaaattgtatatccagtgcttgtgattcttaag
tgtgattctgcagttttgtctggctttttgttgatatttattgcctgtattgtttggctg
aagcttgtatcttttgcacatacaaaccatgatataaggcaactgaccatgggcggcaag
aaggttgataatgaactaagcacagttgacatggataatttacaacctccaactttaggg
aatctaatatacttcatgatggctcctacactctgttatcagccaagctatccccgaact
tcatgtgttagaaaaggttggctgattcgtcaaattattctgtacttgatctttactggt
cttcaaggcttcattattgagcaatacataaatccaattgttgtgaattctcagcatcca
ttgaaaggaggactcctaaatgctgtagagactgttttgaaactctcattaccaaatgtt
tacctgtggctttgcatgttctatgcttttttccatctctggttaagtatacttgctgag
attcttcgatttggtgaccgtgaattctacaaagattggtggaatgcaaaaacaattgat
gagtattggagaaaatggaatatgcctgtacataaatgggttgttcgccatatttacttt
ccttgcatgcgaaatggtatatcaaaggaagttgctgtcttgatatcattccttgtttct
gccgtactccatgagatatgtgtcgctgttccctgccgcattctcaagttctgggcattc
ttaggaataatgctacagatcccccttatcgtattgacagcatacctcaaaagtaaattc
agagatacaatggttggcaacatgatattttggttctttttctgcatctatgggcagcca
atgtgccttctcctgtactatcatgatgtgatgaacaggattgagaaggcaagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340911
Entry
4340911           CDS       T01015                                 
Name
(RefSeq) diacylglycerol O-acyltransferase 2
  KO
K22848  diacylglycerol O-acyltransferase 2, plant [EC:2.3.1.20]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4340911
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     4340911
SSDB
Motif
Pfam: DAGAT Acyltransferase
Other DBs
NCBI-GeneID: 4340911
NCBI-ProteinID: XP_015644342
UniProt: A0A0P0WWA3 Q69PT1
LinkDB
Position
6:12809571..12812430
AA seq 340 aa
MGANGNDVVAAAAAGESPMGAARVVAEGGATVFRGADYSLPRTTVALALWLGGIHFNVFL
VLASLFLFPLRVAAMVVAFQLLFMLIPLNDKDKLGRKIARFICRYAMGYFPISLHVEDYK
CFDPNRAYVFGFEPHSVLPIGVAALADLVGFMPLPKIKVLASSAVFYTPFLRQIWTWLGL
IPATRKNFQSYLGAGYSCIIVPGGVQEILHMDHDSEIAFLKSRKGFVKIAMQSGCPLVPV
FCFGQSYAYKWWRPKGKLFVKIARAIKFTPIVFWGRYGTPIPFPTPMHVVVGRPIEVEKN
SQPTIDEINEVHEQFTVALQDLFDKYKTETGYPGLHLRVL
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgggcgcgaacggcaacgacgtggtggcggcggcggcggcgggggagagcccgatgggg
gccgcgagggtcgtcgcggagggcggggcgacggtgttccgcggcgcggactactcgctg
ccccgcacgacggtggcgctcgcgctgtggctgggcggcatccacttcaacgtcttcctc
gtcctcgcctcgctcttcctcttccccctccgcgtcgccgccatggttgtggcgttccag
ctcctcttcatgctcatccccctcaacgacaaggacaaattgggccgcaagatcgccagg
ttcatatgcaggtacgcgatgggctacttcccgattagtctgcatgtggaggactacaag
tgcttcgatcccaacagggcatatgtgttcggctttgagccacattctgtgctgcccatc
ggagtcgcggcgctcgctgatcttgtcgggttcatgcctctacccaaaattaaggtcctc
gcgagcagcgcggtgttctacacaccgttcctgaggcaaatatggacgtggttaggacta
attcctgcaacgaggaagaattttcagtcatatctcggagctggttatagctgtatcata
gtgcctggaggtgtacaagagattcttcatatggatcatgattcagagattgcctttttg
aaatcaaggaaagggtttgtcaagatagctatgcagtctggctgccctttagttcccgtt
ttctgtttcggacagagctacgcgtacaagtggtggagaccgaagggcaaattgtttgtg
aaaattgctagagcaattaaatttactcccattgtcttttggggaagatacgggacacca
atccctttcccaacgcccatgcatgtagttgttggcagacccattgaggttgagaaaaat
tctcagcctaccattgatgagataaatgaagtccatgaacaatttactgtggccttgcaa
gatcttttcgacaaatacaagacagaaactggatatcctggcctccatctaagagtccta
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341317
Entry
4341317           CDS       T01015                                 
Name
(RefSeq) diacylglycerol O-acyltransferase 1
  KO
K11155  diacylglycerol O-acyltransferase 1 [EC:2.3.1.20 2.3.1.75 2.3.1.76]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4341317
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     4341317
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     4341317
    2.3.1.76  retinol O-fatty-acyltransferase
     4341317
SSDB
Motif
Pfam: MBOAT MBOAT_2
Other DBs
NCBI-GeneID: 4341317
NCBI-ProteinID: XP_015641041
UniProt: A0A0P0WY03
LinkDB
Position
6:21677345..21684418
AA seq 477 aa
MAPPPSLAPDRGGGEPDDALRLRARAAAAAGDAPAPQQQQEQRHQEQQQQLLWYRASAPA
HRRVRESPLSSDAIFRQSHAGLLNLCIVVLVAVNSRLIIENLMKYGLLIRAGFWFSGTSL
ADWPLLMCCLTLPTFPLAALMVEKLAQRKLISKHVVILLHIVITTSVLVYPVVVILKCDS
AVLSGFVLMFLASIIWLKLVSFAHTNYDIRMLSKSIEKGVTHDISIDPENIKWPTFKRLS
YFMLAPTLCYQPSYPRTTYIRKGWVVRQLIKCLVFTGLMGFIIEQYINPIVKNSKHPLKG
NFLNAIERVLKLSVPTLYVWLCMFYCFFHLWLNILAELLCFGDREFYKDWWNAKTVEEYW
RMWNMPVHKWVIRHIYFPCIRNGFSKGVAILISFLVSAAFHELCVAVPCHIFKFWAFIGI
MFQIPLVFLTKYLQDKFNNTMVGNMIFWFFFSILGQPMCVLLYYHDVMNRQQAQTNR
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggccccgcccccctcgctcgcccccgatcgcggcggcggcgaacccgacgacgccctc
cgcctgcgggcccgcgccgccgccgccgccggtgacgctcccgctccgcagcagcagcag
gagcagaggcatcaggagcagcagcagcagctgctctggtaccgcgcgtcggcgcccgcc
caccgccgcgtcagggagagccccctcagctccgacgccatcttccgccagagccatgca
ggccttctgaacctatgcattgttgtgctggttgctgtgaacagcagacttattattgag
aatttaatgaagtatggcctactaattagagctggattttggtttagtggaacatcgctg
gcagattggcctcttctcatgtgctgtctcactttaccaactttcccgcttgctgcactt
atggttgagaagttggctcaaagaaaacttattagtaaacatgtggttattcttctccat
atcgttattacaacatctgtccttgtctatccagttgttgtgattctaaagtgtgattcg
gcagtattatctggatttgtgttgatgtttcttgcaagcattatttggttgaagcttgtt
tcttttgctcatacaaattatgatataagaatgctgtccaaaagtattgaaaagggcgtg
acacatgacatttctatagatccggagaacattaaatggccaacctttaaaaggctatcc
tacttcatgttggccccaacactttgttaccagccaagttatccccgaactacatatatt
agaaaaggttgggtggtccgacaactgataaaatgccttgtttttacaggcttgatgggt
tttataattgagcaatacataaatccaattgtgaagaattcgaagcatccattgaaaggg
aatttcttgaatgctatagagagagtattgaaattatcagtgccaacattatatgtctgg
ctttgcatgttctactgttttttccatctctggttgaatattcttgctgagctcctctgt
tttggtgatcgtgaattctacaaggactggtggaatgccaaaacagttgaagagtattgg
agaatgtggaatatgcctgttcacaagtgggtcattcgacatatatattttccatgcata
aggaatggtttttcaaagggtgttgctatcctaatctcgttcctggtttcagctgcattt
catgagctatgtgttgctgttccatgccacatttttaaattctgggcatttattgggatc
atgtttcagattcccctggtattcttgacgaaataccttcaagataaattcaataacaca
atggtgggcaacatgatattttggttcttcttcagcatcctggggcaaccaatgtgtgtt
ctcttatactaccatgatgtcatgaacaggcaacaagcccaaacaaatagatag

DBGET integrated database retrieval system