KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330512
Entry
4330512           CDS       T01015                                 
Name
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330512
   00030 Pentose phosphate pathway
    4330512
   00051 Fructose and mannose metabolism
    4330512
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     4330512
SSDB
Motif
Pfam: PFK RuvX Antimicrobial19
Other DBs
NCBI-GeneID: 4330512
NCBI-ProteinID: XP_015622692
UniProt: B9F2C7 Q6ZFT9
LinkDB
Position
2:complement(29604453..29610143)
AA seq 617 aa
MDSDYGVPRELSEVQKKRALYQPELPPCLQGTTVRVEYGDAAIAADPAGAHVISHAFPHT
YGQPLAHFLRKTANVPDATVISEHPVVRVGVVFCGRQSPGGHNVIWGLHEAIKAHNPNSK
LIGFLGGSDGLLAQKTLEITDEVLSSYKNQGGYDMLGRTKDQIRTTEQVNGAMASCQALK
LDALVIIGGVTSNTDAAQLAETFAEAKCATKVVGVPVTLNGDLKNQFVETTVGFDTICKV
NSQLISNVCTDALSAEKYYYFIRMMGRKASHVALECALQSHPNMVILGEEVAASKLTIFD
ITKQICDAVQARAEKDKYHGVVLIPEGLVESIPELYALLQEIHGLHGKGVSMENISSQLS
PWASALFEFLPPFIRKQLLLHPESDDSAQLSQIETEKLLAQLVEDEMNRRMKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHVCYHILAAGLNGYMATVTNLKSPANKWRCG
AAPISSMMTVKRWSRGPAATQIGKPAVHMATVDLKGKAFELLRNNSTSFLIDDIYRNPGP
LQFEGAGADSKPISLCVEDQDYMGRIKKLQEYLEKVKSIVKPGCSQDVLKAALSAMSSVT
ETLAIMTSSSTGQGTPL
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggactccgactacggcgtgccgcgcgagctctcggaggtgcagaagaagcgcgcgctc
taccagcccgagctgcccccctgcctccagggcaccactgtgagagtggagtatggtgac
gctgcaattgctgctgatcctgcaggcgctcatgtgatcagccacgcgttcccccacaca
tacgggcagcccctggcccattttctccggaagacggctaatgtccccgatgctactgtc
atatcagagcatcctgttgtcagggttggtgttgttttctgcggaaggcagtccccggga
ggccataatgtcatctggggactccatgaggcaattaaggctcacaacccaaacagcaaa
cttattggttttcttggtggaagtgatggtcttctcgcacagaaaactttggagatcacc
gacgaagttctttcttcatataaaaaccaaggtggttatgatatgcttggccggacaaag
gatcaaattagaacaacagagcaggtcaatggtgccatggctagttgtcaggctttgaag
ttggatgctttagtaatcattggaggtgttacatccaatacggatgctgctcaacttgct
gagacttttgctgaggctaagtgtgcaacgaaggttgtaggtgttcctgtaactttgaat
ggggaccttaagaatcagtttgttgagacaaccgttggttttgataccatatgcaaggtg
aactcacaacttataagcaatgtatgcaccgatgctctttcggctgagaagtattactac
tttattcgcatgatggggcggaaggcttctcatgtggcattggagtgtgctcttcaatca
catccgaatatggttatcctaggtgaggaggttgctgcatcaaaacttaccatctttgat
atcacgaagcagatatgtgatgcagttcaggcaagggctgagaaggataagtatcacgga
gttgtacttattccggagggactcgtggagagtattcctgaattatatgctttgcttcag
gaaattcatgggcttcacggcaaaggtgtttccatggagaatatctcctcacagctttca
ccttgggcatctgcactatttgagtttttgcccccatttattaggaagcagctgcttctc
catcctgaatctgatgactcagctcaactttctcagattgaaaccgaaaaacttttggcc
caattagttgaggatgaaatgaacaggcgtatgaaggaaggcacttacaaaggaaagaaa
ttcaatgcgatctgtcacttttttggctaccaagctaggggttcactgccttcaaagttt
gactgcgattacgcctatgttcttgggcacgtgtgctaccacatcttagctgctggtttg
aatggttacatggctactgtgacaaatcttaagagtcctgcgaacaaatggcgatgtggt
gcggctccgatttcgtctatgatgaccgtgaagagatggtcacgtggtcctgcggctact
caaatagggaaacctgctgtccatatggctactgtcgacttgaaaggcaaagcattcgag
ctattgaggaacaattctaccagcttcttaatcgacgacatctacagaaacccaggacca
ctccaattcgaaggagcaggtgctgattcaaagcctatttcactgtgcgtggaagatcaa
gactatatgggcaggatcaagaaactccaggaatacttggagaaggtgaaaagcatcgtg
aagcctgggtgctcgcaggatgttctcaaggcagcgctgagcgctatgtcatctgtgacc
gagacattggcgatcatgacatcgtcttccactggccagggaaccccactctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340643
Entry
4340643           CDS       T01015                                 
Name
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit beta
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340643
   00030 Pentose phosphate pathway
    4340643
   00051 Fructose and mannose metabolism
    4340643
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     4340643
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 4340643
NCBI-ProteinID: XP_015643982
UniProt: Q0DD75
LinkDB
Position
6:complement(7648926..7654301)
AA seq 567 aa
MAAAAVAANGGGDGAQASNAPAPTRLASVYSEVQTSRLKHALPLPSVLRSPFALADGPAS
SAAGNPGEIAKLFPNLFGQPSVSLVPSPEPASTRPLKVGVVLSGGQAPGGHNVICGIFDY
LQEYAKGSVMYGFKGGPAGVMKCKYVELTADYVYPYRNQGGFDMICSGRDKIETPEQFKQ
AEDTVNKLDLDGLVVIGGDDSNTNACLLAEYFRGKNMKTRVIGCPKTIDGDLKCKEVPTS
FGFDTACKIYSEMIGNVMTDARSTGKYYHFVRLMGRAASHITLECALQTHPNVALIGEEV
AAKKETLKSVTDYITDIVCKRAELGYNYGVILIPEGLIDFIPEVQKLIAELNEILAHDVV
DEAGAWKSKLQPESRQLFDFLPKTIQEQLLLERDPHGNVQVAKIETEKMLIAMVETELEK
RKAEGKYPAHFRGQSHFFGYEGRCGLPTIFDSNYCYALGYGSGALLQCGKTGLITSVGNL
AAPVEEWTVGGTALTSLMDVERRHGKYKPVIKKAMVELDGAPFKKFASLRDEWSLKNHYI
SPGPIQFSGPGSNDANHTLMLELGAEA
NT seq 1704 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggtggcggcgaacggcggcggcgacggcgcgcaggcgtccaacgcg
cccgcccccaccaggctcgcgtcggtctacagcgaggtgcagaccagccgcctcaagcac
gcgctccccctcccctccgtcctccgctcccccttcgccctcgccgacggccccgccagc
tccgccgccggcaaccccggtgagatcgcgaagctgttccccaacctgttcggccagccg
tccgtgtcgctggtgccgtcgccggagccggcgtccaccaggccgctcaaggtcggcgtc
gtgctctccggcggtcaggcgcccggcggccacaatgtcatctgcggcatcttcgattac
ctgcaggaatatgcaaaaggatccgtcatgtatggattcaagggaggtccagctggagtc
atgaagtgcaagtacgttgagctcactgcggattatgtgtacccctacagaaaccagggt
ggatttgatatgatctgcagtggtagggacaagattgaaacaccagagcagttcaagcaa
gctgaagacactgtaaacaaacttgatttggatgggcttgttgtcattggtggtgatgat
tcaaacacaaacgcatgccttcttgctgagtacttcagggggaagaacatgaaaactcgt
gtcattggttgcccaaagactattgatggagatctgaaatgcaaggaggttccaacaagc
tttgggtttgacactgcttgcaagatatactctgaaatgattggtaatgttatgactgat
gcacgctcaaccgggaagtactaccactttgtgaggcttatgggacgtgctgcttctcac
attacattggagtgtgctctgcaaacacatcctaatgttgcactcattggagaagaggtt
gctgcaaagaaggaaactcttaaaagtgtcaccgactacattaccgacattgtctgcaag
cgtgcagaacttggttacaactatggtgtgatccttatcccagagggtctgattgatttc
atcccagaggttcaaaaactcattgcagaattgaatgaaattttggcgcatgatgttgtt
gatgaggcaggggcttggaaaagcaagcttcaaccagaatccaggcaactgtttgacttc
ctgcccaaaaccatccaggagcaacttttgcttgaaagagatcctcatggaaatgttcag
gttgcaaaaattgaaacagagaaaatgcttattgccatggttgagactgaattggagaag
agaaaagctgaggggaagtaccccgcacatttcagaggccaatctcacttctttggatat
gaaggaagatgtggccttcctactatttttgattctaactattgctatgcgttaggctac
ggttctggggcacttctccaatgtgggaagacaggactgattacgtcggttggcaacctc
gctgctcctgtggaagaatggaccgttggtggaactgcattgacatcgttgatggatgtt
gagaggaggcacggaaagtacaagccagtgatcaagaaggctatggtggaacttgacggg
gcaccgtttaagaagtttgcttcattgcgagatgagtggtccctcaagaaccattacatc
agccctggtcccatccagttcagtggccctggaagcaacgatgcgaaccacaccttgatg
ttggaactcggcgccgaggcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340909
Entry
4340909           CDS       T01015                                 
Name
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340909
   00030 Pentose phosphate pathway
    4340909
   00051 Fructose and mannose metabolism
    4340909
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     4340909
SSDB
Motif
Pfam: PFK RuvX
Other DBs
NCBI-GeneID: 4340909
NCBI-ProteinID: XP_015643847
UniProt: B9FT08 Q0DCI1
LinkDB
Position
6:12794247..12800359
AA seq 622 aa
MGSVAMDSDYGVPRELSALQKARALYRPDLPPCLQGTTVKVEYGDAAIAADVAGAHVISH
AFPHTYGQPLAHFLRKTAAVPDATVITEHPVVRVGVVFSGRQSPGGHNVIWGLHDAIKAH
NANSKLIGFLGGTDGLFAQKTLEISDEVLSSYKNQGGYDLLGRTRDQIRTTEQVNAAMTA
CQALKLDALVIIGGVTSNTDAAQLAETFAESKCSTKVVGVPVTLNGDLKNQFVETTVGFD
TICKVNSQLISNVCTDALSAEKYYYFVRLMGRKASHVALECALQSHPNMVILGEEVAASK
LTIFDITKQICDAVQARAEKDKNHGVVLIPEGLVESIPELYALLQEIHGLHDKGVSVENI
SSHLSPWASALFEFLPPFIRKQLLLHPESDDSAQLSQIETEKLLAQLVEAEMNKRLKEGT
YKGKKFNAICHFFGYQARGALPSKFDCDYAYVLGHVCYHILAAGLNGYMATVTNLRSPVN
KWKCGAAPITSMMTVKRWSRGPAASQIGKPAVHMASIDLKGKPYELLRQNSSSFLMEDIY
RNPGPLQFEGPGGETKPISLCVEDRDYMGRIKQLQEYLEKVKSIVKPGCSQDVLKAALSA
MASVTEMLTIMSSPSFSGQATI
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgggcagcgtggcgatggactccgactacggcgtgccgcgcgagctgtcggcgctgcag
aaggcccgcgcgctctaccgccccgacctcccgccctgcctccagggcaccacggtgaag
gtggagtacggcgacgcggctatcgcggccgacgtggcgggcgctcatgtcatcagccac
gccttcccgcacacctacggccagccgctggcgcatttcctcaggaagactgctgctgtg
ccggatgctaccgtcataacagagcaccctgttgtcagggttggtgttgtcttcagtggg
aggcagtccccaggtgggcacaatgttatatggggactccatgatgctataaaggctcac
aacgcaaacagcaagctcattggtttccttggaggaactgatggattgtttgcacagaaa
actttggagatctccgatgaggtcctttcctcttataaaaatcaaggtggttatgatttg
cttggacggacaagggatcagatcagaacaactgaacaagtgaatgctgcaatgactgct
tgccaagccttgaagttggatgctcttgtaataattggaggtgttacatccaacacggat
gctgctcagcttgctgagacttttgctgagtcaaagtgttcaacaaaggtagttggtgtt
cctgtaactctgaatggggaccttaagaaccagtttgttgagacaactgttggttttgat
accatatgtaaggtgaattcgcagctcataagcaatgtctgcactgatgctctttctgct
gagaagtattactactttgttcggctgatgggacggaaagcatctcatgtggctttggaa
tgtgctcttcaatcgcatccaaatatggttatactaggtgaggaggttgctgcatcaaaa
cttacaatttttgatatcacgaagcagatatgtgacgcagtccaggcaagggctgaaaag
gacaaaaatcatggtgttgtacttattcctgagggacttgttgaaagtatccctgaatta
tatgctttgcttcaggaaattcatgggctacatgataaaggtgtttctgttgagaacata
tcttctcatctttcgccttgggcttcagctctatttgaatttttgcctccatttattagg
aaacagctacttcttcatcctgaatccgatgactccgctcaactttctcagattgagact
gagaaacttctagcccaattagttgaagcagaaatgaacaaacgtctgaaggaaggcact
tacaaaggaaagaagttcaatgcaatttgtcacttctttggctaccaagccagaggtgcc
ctaccctcaaagttcgactgtgattatgcttatgttcttgggcatgtatgctatcacatc
ttagctgctggcttaaatggctacatggccactgtgacaaatcttaggagtcctgtgaac
aagtggaaatgcggtgctgctcctattacttccatgatgaccgtaaagcgatggtcacga
ggaccagctgccagtcaaattgggaagcctgctgttcacatggcgagtatcgacttaaaa
ggaaaaccatatgagttgttgagacaaaactcttccagcttcttgatggaagacatctac
agaaaccctggtcctctgcaatttgagggaccaggtggagagacaaagccgatttcattg
tgtgtcgaagatcgagactacatggggaggatcaaacaattgcaggagtatttggagaag
gtcaaaagtattgtgaagcctggatgctcccaggatgtcctgaaggcagcgttaagcgcc
atggcctctgtgacagagatgctaaccatcatgtcttctccctctttcagtggccaagca
accatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345338
Entry
4345338           CDS       T01015                                 
Name
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4345338
   00030 Pentose phosphate pathway
    4345338
   00051 Fructose and mannose metabolism
    4345338
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     4345338
SSDB
Motif
Pfam: PFK SMC_Nse1 RuvX
Other DBs
NCBI-GeneID: 4345338
NCBI-ProteinID: XP_015650397
UniProt: B9G0G9 Q84QT9
LinkDB
Position
8:15658493..15663869
AA seq 617 aa
MNADFGAPKDLAGGLQQRRSLYQPTLPPCLQGATVKVEYGDATTTIDPTCANVVAQAFPR
TYGQPLVSFVAPPPDAVDKDRAPIRVGVVFSGRQSPGGHNVIWGLHDALKAYNPHSVLYG
FVGGTEGLFANKTIEITDDVLASYKNQGGFDLLGRSIDQIRSTKQVNAAMTTCNNLNLDG
LVIIGGVTSNSDAAQLAEALVQNNCKTKVVGVPVSLNGDLKNQFVETTVGFDTVCKVNSQ
LVSNVCLDAISAGKYYYFVRLMGRKASHVAFECALQSHPNMLILAEEVALSKLTLMEVIN
KICDGVQARAELGKFHGVLLIPEGLIESIPEMYALLQEINILHNNNVPVAEMPSQLSPWA
AALFQFLPPFIRRELLLHQESDNSAQLSQIDTEQLLAHLVEAEMIKRTKEGRYKGRKFSS
VCHFFGYQARGSVPSNFDCDYAYALGRISLHMIAAGLTGYMATVANLKDPVDKWRCAAAP
LTAMMSVKRHLRGPGAIPIGKPAIHPSPIDLKGKAYELLREKASSFLLDDFYRTPGGIQY
EGPGCNAKPITLTIENQDYMGDIEILKDCLSKVRTMVKPGCSREVLKAAISSMLSVTDVL
TVMSHPLNAELPLYHFN
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgaacgccgacttcggcgcgcccaaggacctcgcggggggcctccagcagcggaggtct
ctctaccagcccaccctccctccctgcctccagggcgcaacggtgaaggtggagtatggc
gacgccaccaccaccatcgacccaacctgcgccaacgtcgtcgcgcaggccttcccccgc
acctacggccagccgcttgtcagcttcgtcgcgccgccgcccgacgccgtcgacaaggac
cgcgccccgatcagggtaggggtggtgttctccggcaggcagtcgccgggaggccacaac
gtgatctggggactccacgacgctctcaaggcttacaatcctcatagtgttctctatgga
ttcgtcggtggcactgagggactgtttgcgaacaagacaatcgagatcacggatgatgtt
cttgcttcatacaagaaccaaggtggttttgatttgctcggtagaagtatcgatcagatc
cgcagcactaagcaagtcaatgctgcaatgactacatgcaacaacctcaacttggatggc
ctggtcatcatcggaggagtgacatccaattcagatgctgcacagcttgcagaggccctt
gtccagaataactgtaagaccaaggttgtcggtgtgcctgtttcactgaatggtgatctt
aagaaccaatttgttgaaacaaccgtgggatttgatacagtgtgcaaggttaactctcag
cttgtgagcaatgtttgccttgatgcaatctcagctggaaagtactactattttgtccgt
ctgatgggtagaaaagcatctcacgtggcctttgaatgtgcacttcaatcacacccaaac
atgcttatcttagcggaggaggtagcactatcaaaactcacactgatggaagttattaac
aagatatgtgatggagtacaagcaagggcagaattagggaaattccatggtgtgctcctt
attccagaaggactaatagaaagcattccagaaatgtatgctctgcttcaggaaatcaat
atcctccacaacaacaatgttcctgtggcagagatgccatcacaactgtctccttgggca
gctgcgctgttccagttcttgccacccttcatcagaagagagctgctgctccatcaagaa
tcagacaactctgcccagctgtcccagattgatactgagcaattgttggcccacttagta
gaagcagaaatgataaagagaacaaaagaaggaagatacaagggaaggaagttcagctct
gtatgccatttctttggatatcaggctcgaggatccgtcccatcaaactttgactgtgac
tatgcttatgctcttggccgtatctccttgcatatgatagcagctggcttgactgggtac
atggcaactgtggctaatctgaaggaccctgtagacaagtggcggtgtgctgctgctcct
ctaactgcaatgatgagtgtgaagaggcatttgcgtggtcctggggcaatcccgatagga
aagcctgccattcatccttctccaattgacctgaaagggaaggcttatgagttgctgcga
gagaaagcatcaagttttctccttgatgatttctacaggactccaggaggcattcaatat
gaaggcccgggttgcaatgcaaaacccatcacattgaccattgagaaccaagactacatg
ggcgacattgagatactgaaagactgtctcagcaaggtgaggacgatggtgaagcctgga
tgctcgcgggaggttctgaaggcggcgataagctcgatgctgtcggtgaccgacgtgctg
acggtgatgtcgcacccgctcaacgccgagctgccgctctaccatttcaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271821
Entry
9271821           CDS       T01015                                 
Name
(RefSeq) pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha isoform X1
  KO
K00895  diphosphate-dependent phosphofructokinase [EC:2.7.1.90]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9271821
   00030 Pentose phosphate pathway
    9271821
   00051 Fructose and mannose metabolism
    9271821
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     9271821
SSDB
Motif
Pfam: PFK RuvX
Other DBs
NCBI-GeneID: 9271821
NCBI-ProteinID: XP_015612222
UniProt: R9TFH5
LinkDB
Position
9:7240244..7245010
AA seq 627 aa
MSMNADLGKPRELTGLQQRRALYQPELPPCLEFFNQHVQGKAIRVEFGDSTTTIDPTCAN
MVVQEFPNTFGQPLVHFLKPNKMDAQANDEHPPIRVGVVFSGRQSPGGHNVIWGIYDAMK
TQNLQSVLLGFIGGTEGLFANQTLEITDDVLSAYRNQGGFDFLGRTVDQIHTTEQVNAAM
STCCDLDLDGLVIIGGVTSNSDAAQLAETFANHNCKTKVVGVPVSLNGDLKNQFVETTVG
FDTVCKVNSQLISNVCLDAISAGKYYHFVRVMGWKASHVALECALQSQPNMVILGEEVAF
SKLTLKEIISKICDGVQARAAQEKYHGVLLISEGLIESIPEMFALIQEINILHSNKVPEN
NIPSQLSPWATALYNYLPPFIRRELLLHQDSDNSAQLSQIDTEQLLAHLVEAEMNKRMKE
GKYIGRKFSSVCHFFGYQARGSLPSNFDCDYAYVLGHICMHILAAGLNGYMAFATNLKEP
TNKWRCAAVPLTAMMSVKRHSRSPGAVPTGKPVIHPSPVDLQGKAYALLREKASSFLLDD
FYRTPGGIQFDGSGTNVKPITLTVEDQDYLGDIELLQDYLEKVRNIVKPGCSREILKAAI
SSMSSVKDVLKVMSAPFYAELPLFNLN
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgtccatgaacgcggacctcggcaagccgagggagctcaccgggttgcagcagaggagg
gctctgtatcagccggagctgcctccatgccttgagtttttcaaccaacatgttcaggga
aaggccatcagagtggagtttggcgattcgacgacgaccatcgacccgacatgcgcaaat
atggttgtgcaggaatttcccaacacctttggtcagcctctggtacatttcctgaagccg
aacaagatggatgcgcaagccaacgatgaacatccaccaatcagggttggtgtggtgttc
tctgggaggcaatcgccaggggggcacaatgtgatatggggcatctatgatgctatgaaa
actcaaaatctacaaagtgttttgcttggatttattggtggcacagaaggcctatttgca
aatcagacattggagatcacagatgatgttctttcagcatatagaaaccaaggtggtttt
gattttctcggcagaactgttgatcaaatccacacaactgagcaagtgaatgctgcaatg
tcaacatgctgtgatcttgacttggatggcctcgtcatcattggaggggtgacctccaat
tcagatgctgctcagcttgcagaaacatttgccaatcacaactgcaagacaaaggttgta
ggcgtgcctgtttcattaaatggtgatctcaagaatcagtttgttgagacaactgttggg
tttgatacagtgtgcaaggtgaattcccagcttataagtaatgtttgcctcgatgcaatc
tcagctgggaagtactaccattttgtccgtgtgatgggttggaaagcatctcatgttgcc
ttggagtgtgcacttcaatcacaaccaaatatggttattttaggggaagaagtggcattt
tccaagctcactttgaaggaaattataagcaagatatgtgatggagtgcaagcaagggca
gcacaagagaagtaccatggtgtattacttatttcggagggactaatcgaaagcattcca
gaaatgtttgcacttattcaggaaattaatattctccacagcaataaagttcctgagaac
aacattccatctcaactttctccatgggctactgccttgtataattacttgcctcctttc
ataagaagagagttgctgctacatcaagactccgataactcagcacaattgtcccagatt
gatactgagcaactcttagctcatttagtagaagcagaaatgaacaagcgaatgaaagag
gggaaatacattggaaggaaattcagctccgtttgccactttttcgggtatcaagcgcga
ggatccttaccatcaaacttcgattgtgattacgcctatgttcttggtcatatctgcatg
cacatactagcagctgggctgaatggttacatggcttttgcaacaaatctgaaggaacca
acaaacaaatggcgatgcgctgccgttcctctaacagcaatgatgagtgtgaagaggcac
tcacgcagtcctggagctgttcctactggaaagccagttatccatccttctccagttgac
ctgcaagggaaggcttatgcgctcctgagagagaaagcctcgagcttcctattagatgat
ttctacagaactccagggggcattcaatttgatggatctggaacaaatgttaagccaatc
acactgactgtcgaagaccaagactacctgggtgacattgagctactgcaagactacttg
gagaaggtgaggaacattgtgaagcccggatgctcgagggagatcctgaaggcggcgata
agctcgatgtcatcagtgaaggatgtgctgaaggttatgtcggctcccttctatgcagag
ctccctctgttcaatctgaactga

DBGET integrated database retrieval system