KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330568
Entry
4330568           CDS       T01015                                 
Name
(RefSeq) enhancer of mRNA-decapping protein 4
  KO
K12616  enhancer of mRNA-decapping protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4330568
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4330568
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4330568
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4330568
SSDB
Motif
Pfam: Ge1_WD40 WD40 DUF244 DUF445
Other DBs
NCBI-GeneID: 4330568
NCBI-ProteinID: XP_015626168
UniProt: A0A0P0VP77 Q6Z5M6
LinkDB
Position
2:complement(30015996..30025930)
AA seq 1339 aa
MATPTGNPNPNPNPSTPFEVSMLFKPPSNAPAAAPIFPGGPAAGPPPPSAAYSYPPATPP
FHRAPFLHYPQDPMAAPHMPRPVISFPMPTPNPAAIPSAAAAAAAAAGPSQNHGARLMQL
LGSSGPAHLDSSASMPPPASEFAAAQPPQPIPAMPSAPPARMLSSTSSKMPRGRLLGGGD
RAVHDVDSRLPGEAQPPQLEVTPITKYTSDPGLVLGRQIAVNRTYIVYGLKLGNIRVLNI
NTALRSLLRGHTQRVTDMAFFAEDVHRLASASVDGRIYVWKIDEGPDEDSKPQITGKIEI
AIQIVGDAESYHPRICWHSHKQEILFVGIGNCVLRIDTTKVRRGRDVSAEEPIKCHLDKL
IDGVRLVGKHDDDVTDLSLSQWMTTRLASGSKDGTVKIWDDRKPVPLSILKPHDGQAVYS
VAFLTAPEHPDHINLVTAGPLNREVKIWASANEGGVLLPSDSETWNCTQTLELVSSLEPR
VEEAFFNQVTVLPQASIILLANAKKNAIYAVHVEYGTDPASTRLDYIADFTVAMPILSLT
GTHESQPGNDQVVQVYCVQTMAIQQYGLDLSLCSPPTSETTGLGRDPSISRVHETPLEVV
GAESSMPTSFTDSYSVGSPSKSSTVDQQSELDPKPSAPPLTYTEGDGSVHLPSASLASNM
DPSGSGSSLGNLEMDQPAFDYAMNRNVEPKILTRQDTPMPKDNFGKDDPRDGRNDVTMLP
NPHLMFKVGGNTTHLVTPSEIISGALSSAESNHVPKSDGVKIQDGTSSGHQMAEVEPKHT
NEHTFDQNLDLEVAQVVCENTKQAGSSEQTVKMISERSVTTDKYSVEESQTSCDRSISEH
TGAADESVTKKPVEVPEKSDYSSASVEQSSSYTKKEKIMHPQASGQSSPSTSAFNSTESS
HEPPSSAYPPINSFPEVTTQGMLQQLIAMHKDLQKQLGTIVVAPLAKEGKRIEASLGRTM
EKSIKANLDALWVRIQEENAKREKAERERMQQMITLITNSISKDLPATLEKSLKKEISSL
GPVIARAITPIIEKCSASAVADSIQKVVGDRVVNQLDKSVSAKLEATVARQIQMQFHTSV
KQTLQDALRASLEAFLVPAFEQSCKTMFEQVDSAFQKGMSEHTVAIQQQVEATHTPLAQT
LKDTISSASSITQNLTAELLDGHRKLLALLASGNAKAHSTNVLQPNNVPVTGPPEVEAPL
DPMKELGRLISERKFDEAFTMALQRSDVSIVSWLCSQVDLRALCSMVPVPLNQGVLLALL
QQLAVDIATDTPRKIQWMTDVAMAINPTDPVIAMHVKPIFEQVYNALLHLRSLPTTSPSD
STSIRLFMHVINSVLLSYK
NT seq 4020 nt   +upstreamnt  +downstreamnt
atggcgaccccgaccggaaaccctaatcctaaccccaaccctagcactcccttcgaggtc
agcatgctgttcaagccgccctccaacgcccccgcggccgcccccatcttccccggcggc
cccgccgcgggcccgccgccgccgtccgccgcgtactcctacccgcctgcgactcccccc
ttccaccgcgccccgttcctccactatccgcaggaccccatggcggcgccgcacatgccc
cgccccgtcatctccttcccgatgccgaccccgaacccggccgctatccccagcgccgcc
gccgccgccgccgcagccgcggggcccagccagaaccacggcgcgcgcctcatgcagctc
ctggggagctccgggccggcccacctcgattcctccgcctccatgcccccgccggcgtcg
gagttcgccgccgcgcagccgccgcagccgatccccgcgatgccgtcggcgccgccggcg
aggatgctgagcagcacgagcagcaagatgccgcgggggcgccttctcggcggcggggac
agagcggtgcacgacgttgactcgaggctgccgggggaggcgcagccgccgcagctggag
gtgacgccgatcaccaagtacacatcggatcccgggctcgtgttgggcaggcagatcgcc
gtgaacaggacgtacatcgtgtatgggcttaagctcgggaacatccgcgtgctaaacatc
aacaccgcgctccgttcgctccttcgtggccacacacagagggtgacagatatggctttc
tttgctgaggatgttcatcgtttagcaagtgcaagtgtagatggtcggatatatgtttgg
aagattgatgagggtcctgatgaggacagcaaaccacaaattacaggaaagattgaaatt
gccatccagattgttggcgatgctgaatcttaccatccaaggatctgttggcactctcat
aagcaggagattctgtttgttggcattggaaactgtgtcttaagaatagacacaactaaa
gtgcgacggggaagggacgtaagtgcagaggaacctatcaagtgtcatcttgacaagctc
attgatggtgtgcgcttagttggtaagcatgatgatgacgttacagatttgtccttatct
caatggatgactacccgactggcttcaggatcaaaagatggcacggtaaaaatttgggat
gatcgcaagccagtgcctctatcgattctgaagccacatgatggtcaagctgtttattct
gttgcttttctcacggcacctgagcatccagaccatataaacctcgttacagcaggtcct
ctaaaccgagaagttaaaatttgggcttctgccaatgaaggaggtgtgttgttgccaagt
gattccgagacttggaattgcacacagacattggaacttgtcagctcactggaacccagg
gtagaggaggcatttttcaaccaagttaccgtgctgcctcaagcaagtattattttactt
gcaaatgctaagaaaaatgctatttatgctgtgcatgttgagtatggcacagatcctgct
tcaactcgcttggattatatagcagattttacagttgcaatgcctattttaagtctcact
ggcacacatgaaagccaacctggcaatgaccaagttgtacaagtttattgtgttcaaaca
atggctatccagcagtatgggctggatttatcactctgttcacctcctacaagtgaaact
actggacttggaagggatccatctatttctcgtgttcacgagacacctctggaagtggta
ggagcagagtcatccatgccaactagcttcaccgattcttattccgtcggttctccaagt
aaatcatcaaccgttgatcaacagtctgaacttgatcctaaaccatcagctccaccactt
acatacacagaaggtgatggttctgttcatcttccatcagcctctcttgcatcaaacatg
gacccttctggatcaggatcgtcactaggtaaccttgaaatggaccaaccagcttttgat
tatgcgatgaacagaaatgtggagcctaaaattttgactaggcaagatacacccatgcct
aaggacaactttggaaaggatgatccaagagatggtcgcaatgatgttacaatgcttcca
aatcctcatttgatgtttaaggtaggagggaacactacacacttggtaactccatctgaa
atcatatctggcgctctatcttcagctgagagcaaccatgtccctaagtctgatggagtg
aaaatccaggacggcacaagtagtggtcatcagatggcagaagtagaaccaaaacatacc
aatgagcacacatttgatcaaaatttggaccttgaagtagcacaggttgtttgtgagaat
acaaagcaagctggttcatcggagcaaactgttaaaatgattagtgagcgctcggtaaca
actgataagtacagtgtggaagaatcacagacatcatgtgatcgatccatttctgagcat
actggtgctgctgacgaaagtgttacaaaaaaacctgttgaagtgcctgagaaaagtgat
tattcctctgcttctgtggagcaatcatcttcatataccaagaaggagaaaattatgcat
cctcaagcatctgggcagtcatctccttctacaagcgcattcaactcaactgagtcttca
catgaacctccgagtagtgcataccctcctatcaattcatttccagaagttactacgcaa
gggatgcttcaacagctcatagcaatgcataaggacttgcaaaagcagctgggtactatt
gttgttgcacctcttgcaaaggaaggcaaaagaattgaggcatcattagggcgcaccatg
gagaaatctatcaaggctaaccttgatgccttgtgggttcgtatccaggaggagaatgca
aaacgagaaaaggctgaaagagagcgaatgcagcaaatgattactcttatcactaattca
ataagcaaggaccttcctgctactttggagaagtcactgaagaaagaaatttcttcactt
ggacctgttattgcacgggcaataacacctattatcgagaagtgttcagcctctgcagtt
gctgattcaattcagaaagtggttggtgacagagtggtgaatcagctggacaagtctgtt
agtgcaaaacttgaagctactgttgctagacaaatccaaatgcagttccacacatctgta
aaacagacccttcaggatgctttacgtgctagcctggaagctttccttgttccagcgttt
gaacaatcttgcaagacaatgtttgagcaagtcgatagcgcattccagaaaggaatgtct
gaacacactgttgctattcagcagcaagttgaggcaacacataccccattggcgcaaact
ttaaaggataccatctcttctgcgtcttcgatcacccagaatcttacagcagagttgctt
gatggccatcgcaaactattggcgctgcttgcatcgggcaatgcaaaagcacatagtaca
aacgttttgcagcccaacaatgtccctgtgactggtccaccggaggttgaggctccatta
gatccaatgaaggagttgggcagactgatatctgaacgcaaatttgacgaggcatttaca
atggctcttcaaagaagtgacgtgtcgatagtgtcttggttgtgctctcaggttgatttg
cgcgcattgtgctcaatggtccccgtcccccttaaccagggggtcctcctagccctattg
cagcagctagcagttgacattgctactgatacgccgcggaagattcagtggatgacagat
gtcgctatggcgataaatccaaccgatccggtgatcgccatgcacgtgaagcctattttc
gagcaagtctacaatgcattgctccacctacgctcgctccccaccaccagcccatcagac
agcaccagcatccgcttattcatgcatgtaattaattctgttctgcttagctacaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340825
Entry
4340825           CDS       T01015                                 
Name
(RefSeq) enhancer of mRNA-decapping protein 4 isoform X1
  KO
K12616  enhancer of mRNA-decapping protein 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4340825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4340825
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4340825
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4340825
SSDB
Motif
Pfam: Ge1_WD40 WD40 DUF445
Other DBs
NCBI-GeneID: 4340825
NCBI-ProteinID: XP_015643577
UniProt: Q5ZA32 A0A0P0WVR0
LinkDB
Position
6:11219926..11228545
AA seq 1334 aa
MASPSGNPNPTPNQPFELNRLFKQHPPASASASAAPNPNHHPAPAGIFPGAAAPAPHHGV
VVPPPMTSGGGPYSYPPATPPFHRGPYLPPYPNDPHLAFAGNPNPPAAAAAPNPAGARLM
QLLGNTAPTHLESAVSMPMPSEFSAAAAVAPPAPLPAMPSAPPARMPSSSSSKMPRGRLL
GPGDRAVHDVDSRLPGEAQPPQLEVTPITKYTSDPGLVLGRQIAVNRTYIVYGLKLGNIR
VLNINTALRSLLRGHTQRVTDMAFFAEDVHRLASASVDGRIYVWKIDEGPDEQNKPQITG
KIEIAIQIVGDAETYHPRICWHSHKQEILFVGVANCVLKIDTTKVGRGMDFSREEPLKCP
LDKLVDGVHLVGKHDADITDLSLSQWMTTRLASASKDGMVKIWDDRKSVPLSVLKPHDGQ
AVYSVSFLTAPEHPQHINLITAGPLNREVKIWASTNDEGWLLPSDSETWRCTQTLELVSS
LEHRFEEAFFNQVAVLPQASLILLANAKKNAIYAVHVEYGPDPASTRLDYIADFTVAMPI
LSLTGTHESQLDTEQIVQVYCVQTMAIQQYGLELSLCLPPTADNPGFGRDPAISHVYERP
PAEVTVVESSKETSLIDSSVVGPTKPASNNQALEANVPSQVQSTTPPSSIDLGYLEEGAL
RRGPSRGPSLGDRDIDPSSLDYSSKKRMDSDGASGQGSFGRKDSFGKEEPRGSQGDGTKT
SDPRPMFKVGGNATHLITPSEIISGVLSSPETIATGSSQNVEVDAKHVDGRKSERSVELE
AVKETQIVHEKRERPPKTAEQTVNTISERLVTTDKYSVEDSQSRSADGSVSTLLKHPSGA
GDENTVSEAPEKTSDGYASRNLQLTLATKEEKVLHPQVSRQLSPSTSTYNSADSSHEPPS
NVNPPIDNVPQVGIQETLQQLMAMHSDLQKQLSTIVSAPIAKEGKRIETSLGRNMEKSIK
ANIDAMWARFQEENAKHEKAERERMQHITTLITTAVNKDIPVMLEKSLKKEISSVGPAVA
RTTAPIIEKSLSSAVSDSLQKVLGDKVVNQLDKSLSTKLEATVARQIQTQFHTSAKQALQ
DALRSSFESTIIPAFEQSCKTMFEQVDGAFQKGMSEHGAAIRQQVATAHTPLAQTLRETI
ASASSINQGLASELLDGQRKLLALVSSGGSLSHNTSVLQPSNGPVASLPEVDAPLDPVKE
LSRLISERKFDEAFTMALQRSDVSIVSWLCSQVDLHELCRMNPIPLNQGVLLALFQQLAC
DIVNDTPRKLEWMTAVAVAISPTDPMIAVHVRPIFEQVYGVLNHQRSLPASSSSEATNIR
LIMHVINSVLLTYK
NT seq 4005 nt   +upstreamnt  +downstreamnt
atggcgtctccctcggggaaccctaaccccacccccaaccagcccttcgagctcaaccgc
ctcttcaagcagcatccccccgcctccgcctccgcctccgccgccccaaaccctaaccac
caccccgcccccgccggcatcttccctggcgccgccgcccccgccccccaccacggcgtc
gtcgtcccgccgccgatgacgtccggtggcgggccctactcgtacccgccggccaccccg
cctttccaccgggggccttacctccctccctaccccaacgacccccacctcgccttcgcc
gggaaccctaacccccccgccgccgccgctgctcccaacccggcgggcgccaggctcatg
cagctgctcgggaacacggcgcccacgcacctcgagtcggcggtgtccatgccgatgccg
tcggagttctccgccgccgcggctgtggcgccgcccgcgccgctgcccgcgatgccgtcc
gcgccgcccgcgaggatgccgagcagcagcagcagcaagatgccgagggggaggctcctg
gggccaggggaccgggccgtgcacgacgtggactcgcggctgccaggcgaggcgcagccg
cctcagctggaggtgacgcccatcaccaagtacacgtcggacccggggctggtgctcggc
aggcagatcgccgtgaaccggacctacatcgtgtatggcctcaagctcggcaacatccgc
gtgctcaacatcaacaccgcgcttcgctcgctcctccgcgggcacacacagagggttacg
gacatggctttctttgcggaagatgtccatcggttagcaagtgcaagtgtagatgggcgg
atctatgtatggaagattgacgagggacctgatgagcagaataaaccacaaatcacagga
aagattgaaattgccatacagattgtaggagatgctgaaacttaccatccaagaatatgt
tggcactcccataagcaagagattctgtttgttggagttgctaactgcgtcttaaaaata
gacacaacaaaagtaggaagaggaatggacttcagtagagaagaacctcttaaatgccca
ctcgacaagctggtcgatggcgttcacttggttggtaaacatgatgcagatattacagat
ttgtccctatctcaatggatgactactcgtcttgcttccgcatcaaaagatggcatggta
aagatctgggatgatcgcaaatctgtgcctctgtctgttctgaaaccacatgatggtcaa
gctgtttactctgtttctttccttacggcacctgagcatccccagcatataaatctcatc
acagcaggccctctcaatcgagaagtaaaaatttgggcttccactaatgatgaaggttgg
ttgttgccaagtgactctgagacatggagatgcactcaaacactggagctcgtgagttct
ctggaacataggtttgaggaagcatttttcaaccaagtagcagtgttgccacaagctagc
cttattttgcttgcaaatgccaaaaagaatgctatttatgctgtgcatgttgaatatggc
ccagatcctgcttctactagattggactatatagcggattttacagttgcaatgcctatt
ctaagtctgacaggaacacacgaaagccaactggatactgaacagatagttcaagtgtat
tgtgtccagacaatggctatccagcagtatggattggaattatctctttgtttgcctcct
acagctgataatcctgggtttggtagagatccagctatttctcatgtgtatgagagacct
ccagcagaagtaactgtggtggagtcatccaaggaaactagtctgattgattcctctgtt
gttggtccaactaaaccagcaagcaataatcaggccctagaagcgaatgtcccttcgcaa
gttcaatccacaactcctccatcaagcattgaccttggatatttagaagaaggtgccttg
agaagaggtccttcaagaggtccatctcttggtgatcgtgatatagacccgtcatctctt
gattattcaagtaagaaaaggatggattctgatggtgcaagtgggcaaggttcatttggt
aggaaggatagtttcggaaaggaagagccaagaggcagccagggtgatggtacaaaaacc
tcagatcctcgtcctatgtttaaggtgggaggaaatgctacgcacttgataactccatct
gaaattatttcaggtgtcctttcgtctccagaaacaattgctactggcagttctcaaaat
gtagaagtggatgctaaacatgtggatgggagaaaatcagagcgaagtgttgaacttgaa
gctgtcaaggagacacaaattgttcatgagaaaagggagagacctcccaagactgctgaa
caaactgtaaacacaatcagtgaacgcttggtaacaactgacaaatacagtgtggaagat
tcacaatctcggagtgctgatggatcagtatctacacttttgaaacatccttctggtgct
ggggatgaaaacactgtaagtgaagctccagagaaaactagtgatggttatgcttctagg
aacttgcagttaaccttggctaccaaggaggagaaagttcttcatcctcaagtttctagg
cagttatctccttctacaagcacttacaactctgctgattcctctcatgaacctccaagc
aacgtaaaccctcctattgataacgttccacaagttggtattcaagaaacactacaacag
ctaatggccatgcatagtgacctgcaaaagcagctgagcacaattgtatctgctcctatt
gcaaaggaaggcaaaaggatcgagacatctttaggtcgtaacatggaaaagtccattaag
gcgaacattgatgccatgtgggcccgtttccaggaggaaaatgcaaagcatgaaaaggct
gaaagagagcgtatgcagcatatcactactctcatcacaactgctgtaaacaaggatatt
cctgttatgctggagaagtccctaaagaaagaaatatcttcagttggacctgctgttgca
cggacaacagctcctatcattgagaaatcactatcttctgctgtttctgattcactccag
aaagttcttggtgacaaggttgtgaatcaactggacaaatccctaagtacaaaacttgaa
gctacagtagctaggcagatccaaacgcagtttcatacgtctgccaagcaggcccttcag
gatgctttgcgctctagctttgagtcaacaatcattccagcatttgaacaatcttgcaag
acaatgtttgagcaagtagatggtgcattccagaaaggcatgtctgagcatggtgctgct
atccgtcagcaggttgcaacagcacatactccactagcacaaactctcagggaaacaatc
gcttcagcatcatcgataaaccagggtcttgcatcagagttgcttgatggacagcgtaag
cttttggcacttgtttcatcggggggctccttatcgcataatacaagtgttctgcagcct
agtaatggaccagtggctagtctccctgaggtcgatgctccactggatcctgttaaggag
ctaagcagactgatatctgagcgcaaatttgatgaagcatttacaatggctcttcaaaga
agtgatgtctccatagtgtcttggctgtgctctcaggtcgatctgcacgagttatgcaga
atgaaccccattcctctcaaccaaggggtcctgttggcccttttccagcaactagcatgt
gacatcgtcaatgacacgcccagaaagcttgagtggatgacggctgttgctgttgcaatc
agtccaacagatcctatgatcgctgtgcatgtgaggccgatattcgagcaggtctatggc
gttttgaaccaccaacggtcactgccagcaagcagttcctcggaagcgaccaacatccgt
ttgatcatgcacgtaatcaactcggtgctgctgacctacaagtga

DBGET integrated database retrieval system