KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330613
Entry
4330613           CDS       T01015                                 
Name
(RefSeq) U4/U6 small nuclear ribonucleoprotein Prp31
  KO
K12844  U4/U6 small nuclear ribonucleoprotein PRP31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4330613
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4330613
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4330613
SSDB
Motif
Pfam: Prp31_C Nop
Other DBs
NCBI-GeneID: 4330613
NCBI-ProteinID: XP_015625450
LinkDB
Position
2:complement(30398285..30402642)
AA seq 287 aa
MGCIAPNLSAIVGSAVASKLMGAAGGLEALAKMPSCNLQLLGAKKKNLSGFSTAASQFRV
GYLEQTEVFQSTIPSLRTHACRIISAKSTLAARIDSIRGDPTGKAGHSLLEEICKKTEKL
QELPPAKILKPLPVPDCMPKKKRGGCRLRKMKERYAQTDMMKLANRMQFGVPEESSLGDG
LGKGYGLLGQAGSGKLRLLAGQSRLAAKVAKRFKARSCDRSESRSGLTSTLAFTPVQGME
LSNPLVHNDHSVSGTQSTYFSDVGTFSSIRGKDAIPIQSSEIQNPGV
NT seq 864 nt   +upstreamnt  +downstreamnt
atgggatgtatcgcaccaaacctttctgcaattgttgggagtgctgttgcttcaaaactg
atgggagctgctggtggtttggaagcattggcaaaaatgccctcttgtaatttgcagctt
ctcggtgcaaagaagaaaaatctgtctggattttctactgcagcatcccagtttcgtgtt
ggttatcttgaacaaactgaagtatttcaaagcacaattccatctttaagaactcatgca
tgtagaattatatctgcaaaatcaacactagcagcaaggattgattccataagaggggat
ccaactggaaaagctgggcatagcttgttagaagaaatctgtaaaaagactgaaaagttg
caagaattaccacctgcgaagatcctaaagccacttcctgttccagattgtatgcccaaa
aagaagagaggaggttgtcggctccggaaaatgaaagaaagatatgcacagactgacatg
atgaagctggcaaatcggatgcagtttggtgtgccggaggagagctcattaggtgatggc
ttagggaaaggttatggcttgcttggacaagcaggaagtgggaaactacgtctcttagct
ggccaaagcagacttgctgctaaggttgccaaacgattcaaggcaaggagttgtgacagg
agtgagtcaaggtcggggttaacatcaactctggcatttacaccagtccaaggaatggag
ctttcaaatccactggtgcacaatgaccattctgtcagtggaacccaaagcacttatttt
tcggatgttgggacattttcaagtatcagaggaaaagatgccatccccattcagtcatca
gaaattcagaatccaggggtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336619
Entry
4336619           CDS       T01015                                 
Name
(RefSeq) U4/U6 small nuclear ribonucleoprotein Prp31 isoform X1
  KO
K12844  U4/U6 small nuclear ribonucleoprotein PRP31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4336619
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4336619
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4336619
SSDB
Motif
Pfam: Nop Prp31_C
Other DBs
NCBI-GeneID: 4336619
NCBI-ProteinID: XP_015635443
LinkDB
Position
4:27791756..27795800
AA seq 494 aa
MASLADSFLADLDELSDNEAYPEEENAEAVGTEEIGDDDMPDLESLNYDDLDSVSKLQKT
QRYNDIMQKVENALQKGTDFSNQRSILEEDPEYQLIVDCNALSVDIENEIIIIHNFIRDK
YRLKFPELESLVHHPIDYARVVQKIGNEMDLTLVDLEGLLPSAIIMVISVTASTTSGKPL
SEENLVKTIEACERALTLDAAKKKVLEFVESRMGYIAPNLSAIVGSAVASKLMGTAGGLG
ALAKMPACNVQLLGAKRKNLAGFSTATSQFRVGYLEQTDVFQSTPPALRTRACRLIAAKS
TLAARIDSIRGDPTGKAGRNLLEEIRKKIEKWQEPPPAKLPKPLPVPDFEPKKKRGGRRL
RKMKERYAQTDMMKLANRMQFGVPEESSLGDGLGEGYGMLGQAGSGKLRVSTAPSKLSAK
ITKKFKEKSYGSSGATSGLTSSLAFTPVQVYSAMLLVIAQLRGFYVAILVRLISELICAC
IVTYLQLHRLVFLM
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggcaagccttgctgattctttcttagcggatcttgatgaactttcagacaatgaagcc
tatcctgaggaagaaaatgctgaggcagtgggcacggaagagattggtgatgatgatatg
cctgacctcgagtctcttaattatgatgaccttgatagtgtttcaaagcttcagaaaaca
caacgttacaatgacattatgcaaaaagttgaaaatgcacttcagaaaggtacagatttt
tccaatcaaaggtcgatcctggaggaagatccagaataccagctgattgttgattgcaat
gctctatcagtagatattgagaatgagatcattataatccataatttcatacgtgacaag
tataggctgaagtttcctgaactagaatcccttgttcatcatccgatcgattatgctcgt
gttgtccagaagattggaaatgagatggatttaacgcttgtagatctggaagggctttta
ccttctgcaattataatggtaatttcagtgacagcatcaacgacaagtgggaagccgctt
tccgaggagaacttggtaaaaactattgaagcatgtgagagagcccttactcttgatgct
gcaaagaagaaggtacttgaatttgtagagagcagaatgggttacattgcaccaaacctg
tctgccattgttggcagcgctgttgcctcgaagttgatgggaactgctggtggtttggga
gcacttgcaaaaatgcctgcttgtaacgttcagttacttggtgctaagaggaaaaatctt
gctgggttttctactgccacatctcagtttcgtgttggctatcttgaacaaaccgatgta
ttccagagtaccccaccagctctgaggactcgtgcttgcagacttatagctgcaaagtca
actctagcagcaaggattgattcgatcagaggtgatccaacaggaaaagctgggcgtaac
ttgttagaagaaatccgtaagaagattgagaagtggcaagaaccgcctcctgcaaagctt
ccaaaaccacttcctgttccagactttgagcctaaaaagaagagagggggtcggcggctt
cgaaaaatgaaagaaagatatgcacaaactgatatgatgaagcttgctaaccgaatgcag
tttggtgtaccagaagagagctcattgggtgatggtttaggggaaggttatggcatgctt
ggacaggcaggaagtggaaagctacgcgtgtcaactgcaccaagcaaactttctgcaaaa
attaccaagaaattcaaggagaagagctatggtagcagtggtgcaacatcggggctgact
tctagtttggcgtttacaccagttcaggtgtattctgctatgctgctggttattgcacag
cttcgtggattttatgttgctattcttgtacggctaatatcagagttgatatgcgcctgc
attgtaacatatttgcaattacatcgattagtatttttaatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342372
Entry
4342372           CDS       T01015                                 
Name
(RefSeq) U4/U6 small nuclear ribonucleoprotein Prp31
  KO
K12844  U4/U6 small nuclear ribonucleoprotein PRP31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4342372
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4342372
Spliceosome [BR:osa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6 snRNP specific factors
    4342372
SSDB
Motif
Pfam: Nop Prp31_C
Other DBs
NCBI-GeneID: 4342372
NCBI-ProteinID: XP_015646724
UniProt: Q0D8P4
LinkDB
Position
7:2144127..2152184
AA seq 484 aa
MASLADSFLADLDELSDNEAYPEEENAEAVGMDEDGGEDMLDLESLNYDDLDSVSKLQKT
QCYNDIMQKVEDALQKGTDFSNQGSILEEDPEYQLIVDFNALSVDIENEIIIIHNFIRDK
YRLKFPELESLVHHPIDYARVVQKIGNEIDLTLVDLEGLLPSAIIMVVSVTASTTNGKPL
SEENLAKTIEACERALTLDAAKKKVLDFVESRMGRIAPNLSAIVGSAVASKLMGTAGGLG
ALAKMPACNVQLLGAKKKNLAGFSSATSQFRVGYLEQTEVFQSTPPALRTSACRLIAAKS
TLAARINSIRGDPTGKAGRNLLEEIRKKIEKWQEPPPAKLPKPLPVPDSEPKKKRGGRRL
RKMKERYAQTDMMKLANRMQFGVPEESSLGDGLGEGYGMLGQAGSGKLRVSAAQSKLAAK
VAKKFKEKSYGSSGATSGLTSSLAFTPVQGIELSNPQSHGNLLGSGTQSTYFSETGTFSK
IKRN
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcaagccttgctgattctttcttagcagatcttgatgaactgtcagacaatgaagcc
tatcctgaagaagaaaatgctgaggcagtgggtatggatgaggatggcggtgaagatatg
cttgaccttgagtctcttaattatgatgatcttgacagtgtctcaaagctgcagaagaca
cagtgttataatgacataatgcagaaagttgaggatgcacttcagaaaggcacagacttc
tccaatcaagggtccatcttggaggaggatccagaataccagcttattgttgatttcaat
gctttgtcagtagatattgagaatgaaatcattataatacataatttcatacgcgacaag
tatagactgaagtttcctgaactggaatcccttgttcatcatcctattgactatgcccgt
gttgttcagaagattggaaatgagattgatttgacactcgtagacctggaagggctttta
ccttctgcaattataatggttgtgtcagtgacagcatcaacaactaacgggaagcctctt
tctgaggagaatctggcaaaaaccattgaagcatgtgagagagcccttactcttgatgct
gcaaagaagaaggtgcttgattttgtcgagagcagaatgggtcgcattgcaccaaacctt
tctgctattgttggcagcgctgttgcctcaaaactaatgggaactgctggtggtttggga
gcacttgcaaaaatgcctgcttgcaatgttcagttacttggggcaaagaagaagaatctt
gctggattttctagtgccacatctcagtttcgtgttggctatcttgaacaaactgaagta
tttcagagcacacctccagctctgagaactagtgcttgcagacttatagctgcaaaatca
actctagctgcaagaatcaattcaatcagaggtgatccaactggaaaagctggccggaac
ttgttagaagaaattcgtaagaagattgagaagtggcaagaaccgcctcctgcaaagctt
ccaaaaccacttcctgttccagactctgagcctaaaaagaagagaggaggccgtcggctt
cggaaaatgaaagaaagatatgcgcagactgacatgatgaagcttgcgaaccgaatgcag
tttggggtaccagaagaaagctcattaggtgatggcttgggggaaggctatggcatgctt
ggacaggcaggaagcgggaaactacgtgtatcagctgcgcaaagcaaacttgctgctaaa
gtggccaaaaaattcaaggagaagagctatggtagcagtggtgcaacatctggactgacg
tctagtttggcctttacaccagttcagggaatagaactatcaaatccccagtcccatggg
aacctgctaggcagtggaacacaaagcacttacttttctgagactggaacattttcaaag
atcaagaggaactga

DBGET integrated database retrieval system