KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330669
Entry
4330669           CDS       T01015                                 
Name
(RefSeq) dynamin-2A
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4330669
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330669
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330669
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     4330669
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    4330669
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    4330669
   RhoA-dependent endocytosis
    4330669
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4330669
SSDB
Motif
Pfam: Dynamin_N Dynamin_M GED PH MMR_HSR1 PH_8 ARGLU Apyrase PH_20 AIG1
Other DBs
NCBI-GeneID: 4330669
NCBI-ProteinID: XP_015626661
UniProt: B9F2W8 Q0DXR0
LinkDB
Position
2:complement(30861586..30871165)
AA seq 923 aa
MSSSAMEAMDELVQLAESMRQAASLLADDDPSDEASPRRPSTFLNAVALGNVGAGKSAVL
NSLIGHPVLPTGENGATRAPIVVDLQRDPGLSSKSIVLQIDSKSQQVSASALRHSLQDRL
SKGASGGSGKGRNDEIYLKLRTSTAPPIKLVDLPGIDQRVMDDSTISEYAGHNDAILIVV
IPAMQAADVASSRALRLAKDIDPDGTRTIGVLSKIDQASADAKTVSCVQAILSNKGAPRA
AAEIEWVALIGQSVSIASAQAGSVGSENSLETAWQAEAETLKSILTGAPRSKLGRIALVD
TIAKQIRKRMKIRLPNLLSGLQGKSQIVQNELARLGEQMVSSAEGTRAVALELCREFEDK
FLAHVTSGEGSGWKIVASFEGKFPDRIKQLPLDRHFDINNVKRIVLEADGYQPYLISPEK
GLKSLIKGVLEMAKEPSRLCVEEVHRVLLDIVNASANATPGLGRYPPFKREVVEIATNAL
DVFKSDAKKMVVALVDMERAFVPPQHFIRLVQRRMERQRREDEVKNRSSKKAQDAEQSNK
GSGTGSEQSGGALKSLKEKFSQQDKDKDAKEGPNLQVAGPGGEITAGYLLKKSAKNNEWS
KRWFVLNEKSGKLGYTKKQEERHFRGVIVLEECNLEEIEEEELSKSLKDSKKANGAEKGP
SLVFKITNRVAYKTVLKSHSAVILKAETIADKVEWMKKIRGVIQSKGGSVKGLNTPEGGS
MRQSHSDGSLDTMARKPADPEEELRWMSQEVRGYVEAVLNSLAANVPKAIVLCQVEKAKE
DMLNQLYSKISAQTNAKIEELLQEDHNAKRRREKYQKQSSLLSKLTRQLSIHDNRASVAS
YTNDSSGAESSPRTSGQSGEDWRSAFDSASNGSVDRSSSHNETRSRSADSRGKRYENGDV
NGGNSGSRRTPNRLPPAPPGQKY
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcggccatggaggccatggacgagctcgtccagctcgccgagtccatgcgc
caggccgcctccctcctggccgacgacgacccctccgacgaggccagcccgcgccgcccc
tccaccttcctcaacgccgtcgcgctcggcaacgtcggcgccggcaagtcggccgtgctc
aacagcctcatcggccaccccgtgctgccgacgggtgagaacggggcgacgcgggcgccg
atagtggtcgacctgcagagggatccggggctgagcagcaaatccatcgtcctgcagatc
gacagcaagtcgcagcaggtgtcggcaagtgctctccgccattcgctgcaggacaggctg
agcaagggggcgtccggtggatcagggaaaggccgaaacgatgagatttacctcaagctg
cggacaagtacagctcctccaataaaattggtcgatttgcctggcatagaccaacgagtt
atggatgattcaactatcagtgaatatgctggacataatgatgcaatattgattgttgtg
ataccagcaatgcaagctgctgatgttgcatcatctcgagctctcagactagcgaaggat
attgatccagatggaaccagaacaataggtgttttaagtaaaattgatcaagcatctgca
gatgcaaaaactgtatcttgtgttcaggctatcttgtctaacaagggtgcaccacgagca
gcagctgaaattgagtgggttgctctaatagggcaatctgtctcaattgcatcggcccaa
gctggatcagttggttctgagaactcactggaaactgcctggcaggctgaagcggagaca
ctcaaatccatcctaactggagctcctcgaagtaagctagggagaattgctctcgtggat
accattgctaagcagatacgtaaaaggatgaaaattcggctacctaaccttttgtccggg
cttcaggggaagtctcagatagtgcaaaatgaacttgcaaggttgggagaacagatggta
tcaagcgctgaaggaaccagggctgttgctttggagctttgccgtgaattcgaagacaag
tttcttgcccatgttacttctggtgaggggtctggttggaaaattgttgcaagctttgag
gggaagtttccagataggatcaaacagcttcctttggacaggcattttgatattaacaat
gtcaaaaggattgtcctggaagccgatggttatcaaccatatttgatatctccagagaaa
ggtttaaaatccttaataaaaggagtacttgaaatggcaaaggagccatcacggctgtgt
gttgaagaggtacaccgtgtattattggacatagtaaatgcttctgcaaatgctacacca
ggacttggaagatatcctccattcaaacgcgaggtcgttgaaattgcaaccaatgcattg
gatgtcttcaaaagtgatgcaaaaaagatggtagttgcacttgttgatatggagcgtgcc
tttgtcccaccacaacacttcatccgtttagtacaaagaagaatggaaaggcaacgtcgt
gaggatgaggtgaaaaacaggtcatctaagaaagcccaagatgcagaacagtccaacaag
ggctcaggcacaggatctgagcaatctggtggtgccttgaaatcgttgaaagaaaaattc
agtcagcaagacaaagataaagatgcaaaagagggaccaaatttgcaggttgctgggcct
ggtggtgaaataactgcaggctaccttttgaagaaaagtgcaaaaaataatgaatggagc
aaaagatggtttgtcctaaatgagaagagtggaaagcttgggtacaccaagaaacaagag
gagagacattttcgaggtgttattgtcctggaggaatgtaatctggaagagatagaagag
gaagagctttccaagagtttgaaggattcaaagaaggccaatggggcagagaaaggccca
agtcttgtatttaagattactaacagagttgcctacaaaactgtgctgaaatctcatagt
gctgttatactgaaggccgagactattgctgacaaggttgaatggatgaagaagataaga
ggtgtcattcaaagcaaagggggttctgtgaagggtttaaatactcctgagggtggttcc
atgaggcaaagccattctgatgggtcccttgatacgatggcccggaagcctgctgatcct
gaagaagaacttcggtggatgtctcaagaagttcgtggttatgtagaggctgttttgaac
agtttggcagcaaatgttccaaaggcaatcgtactttgccaagtggagaaagcaaaggaa
gatatgctaaatcagctctacagcaaaataagtgctcaaaccaatgcaaagattgaagaa
cttctccaagaggaccacaatgctaaacgtagacgggagaagtaccaaaaacaatcatct
ctattgtcaaagcttactcgtcagcttagtatccatgacaatagagcttctgttgcatcg
tataccaatgatagttctggagctgagagtagcccacggacctctggccagtcaggtgag
gactggaggtctgcgttcgattctgcatcaaatggctctgttgatcgatccagttcacac
aatgaaacaaggtcaagaagtgctgacagccgtggcaaacgctatgaaaatggggacgtg
aatggtggtaactctggcagccgacgcacaccaaaccgtttgccaccagcacctccaggg
caaaaatattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340644
Entry
4340644           CDS       T01015                                 
Name
(RefSeq) dynamin-2B
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4340644
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4340644
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4340644
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     4340644
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    4340644
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    4340644
   RhoA-dependent endocytosis
    4340644
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4340644
SSDB
Motif
Pfam: Dynamin_N Dynamin_M GED PH MMR_HSR1 PH_8 PH_11 PH_20 AIG1 ARGLU
Other DBs
NCBI-GeneID: 4340644
NCBI-ProteinID: XP_015643697
UniProt: A0A0P0WV24 Q654U5
LinkDB
Position
6:7661696..7670004
AA seq 911 aa
MEAVEELAQLSEAMRQAASLLADDDPSDDSAPRRPSTFLNAVALGNVGAGKSAVLNSLIG
HPVLPTGENGATRAPIVVDLQRDPGLSSKSIVLQIDSKSQQVSASSLRHSLQDRLSKGAS
SGSSRGRVEGINLKLRTSTAPPLKLVDLPGIDQRAVDDSMINEYAGHNDAILLVVIPAMQ
AADVASSRALRLAKDIDADGTRTVGVISKVDQAEGDAKTIACVQALLSNKGPKNLPDIEW
VALIGQSVAIASAQAAGSENSLETAWNAEAETLRSILTGAPKSKLGRIALVDTIAKQIRK
RMKVRLPNLLSGLQGKSQMVQDELARLGESMVQSAEGTRAVALELCREFEDKFLAHITSG
EGSGWKVVASFEGKFPERIKQLPLDRHFDLSNVKRIVLEADGYQPYLISPEKGLRSLIKI
VLDMAKEPSRLCVEEVHRVLLDIVNASANATPGLGRYPPFKREVIAIASNALDSFKNDAK
KMVVALVDMERAFVPPQHFIRLVQRRMERQRREDELKNRSSKKPQDADQPMGKRASSPQT
GSEKDTKDKSAKDKDKDKSGQQDKDAKEGSSVQVAGSSGEITAGYLLKKSAKTNGWSRRW
FVLNEKSGKLGYTKKQEERHFRGVITLEECNLEEVEEEEPPKSLKDSKKANGPEKGPSLV
FKITNRVAYKTVLKAHSAVVLKAESTADKVEWVNKIRAVIQSKGGSFKGPNTDGGSMRQS
NSDGALDTMARRPADPEEELRWMSHEVRGYVEAVLNSLAANVPKAIVLCQVEKAKEDMLN
QLYSSISGQSNAKIEELLQEDHNAKRRREKYQKQSSLLSKLTRQLSVHDNRAASYANDIS
EAESPRTPNRPGEDWRSAFDSASNGPSSGSESRSRSADGRRGRYENGDVTSGANSGSRRT
PNRLPPAPPKY
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggaggccgtcgaggagctcgcgcagctgtcggaggcgatgcgccaggcggcgtcgctg
ctggccgacgacgacccctccgacgactccgccccacgccgcccctccaccttcctcaac
gccgtcgcgctcggcaacgtcggggcgggcaagtcggccgtgctgaacagcctcatcggc
caccccgtgctgccgacgggggagaacggggcgacgagggcgccaattgtggtggacctg
cagagggacccgggcctcagcagcaagtccatcgtgctgcaaatcgacagcaagtcgcag
caggtgtccgcaagttcgctgcggcattcgctgcaggacaggctcagcaagggggcgtcc
agcggatccagtaggggccgtgtagaggggatcaatctcaagctgcggacgagtacagct
cccccactaaagctggttgatttacctgggatagaccagcgagctgttgacgattcaatg
attaatgaatatgctgggcacaatgatgcaatactgctagttgtgatacctgcaatgcaa
gcagctgatgttgcgtcatctcgagctcttaggctggccaaggatattgatgcagatggc
accagaactgtaggtgtgataagtaaagttgatcaagcagaaggagatgcaaaaactata
gcttgtgttcaggcccttctgtcgaataagggcccaaaaaaccttccagatatcgagtgg
gttgctctgataggacaatcagttgcaattgcgtcagctcaagcagcaggttctgaaaac
tcactagaaacagcatggaatgctgaagctgaaaccctcagatccatcttaactggagct
ccaaaaagtaaactaggtagaatagctctggttgacaccattgctaagcagatacgtaaa
cggatgaaagtgcgacttcctaacctattgagtggtcttcagggtaagtcccagatggtt
caagatgaactggcacggctgggagaatctatggtacaaagtgctgaagggactcgggct
gttgctttggaactctgccgggaattcgaggataagtttcttgctcatattacatctggc
gaggggtctggttggaaagttgttgcaagttttgaagggaaattcccagagagaattaaa
cagctgccactggacaggcactttgacctcagcaatgttaaaaggattgtcttggaagcc
gatggttatcaaccgtacctgatatctccagagaaagggttgaggtccttgataaagata
gtattggatatggcaaaggagccatcacgactctgtgttgaagaggtacatcgtgtattg
ttagacattgtcaatgcttcagcaaatgccacaccaggacttggaagatatcctccattc
aagcgcgaggtcattgcaatagcatcaaatgcactagacagcttcaaaaatgatgcaaaa
aagatggttgttgcacttgttgatatggagcgcgcctttgttcctcctcagcatttcatc
cgtctagtgcaaagaagaatggaaaggcaacgccgtgaggatgaattaaaaaatcgatcc
tccaagaaaccacaggatgctgaccaacccatgggaaaaagggcctccagtccccagaca
ggatctgagaaagacacaaaagacaaatcagcgaaagacaaagacaaagacaaatcaggc
cagcaagacaaagacgcaaaagaggggtcctctgtgcaggttgctggttcttctggtgaa
attactgcaggttaccttttgaagaaaagtgcaaaaacaaatggatggagtaggaggtgg
tttgtcctcaatgagaaaagcggaaagcttggctacacgaagaaacaagaggagagacat
tttcgtggtgtcatcactcttgaggagtgtaaccttgaagaagtagaggaggaagaacct
cctaaaagtttgaaggattcaaaaaaggcaaatgggccagagaaaggcccaagtctcgtc
tttaagataactaacagggttgcctacaaaacagttctaaaagctcatagtgctgttgta
ttgaaagctgagagcacggccgacaaagttgagtgggtaaataagatacgggctgtaatt
caaagcaaagggggatcattcaagggtccaaatactgatggtggttccatgagacaaagc
aattccgatggtgctctggatactatggcacggagacctgctgatcctgaagaagaactt
agatggatgtcccatgaagttcgtggttatgttgaggctgttttgaatagtctggcagca
aatgtcccaaaggctattgtgttgtgccaagtggagaaggcaaaggaagatatgctaaac
cagctatatagttcaataagtgggcaaagcaatgcaaaaattgaagagcttctgcaagag
gaccataatgctaaacgtagaagggaaaaataccaaaaacaatcatctctcttgtcaaag
cttacccgtcaacttagtgtccatgacaacagggctgcttcttatgccaatgatatctct
gaagctgagagcccccggacacccaaccgcccaggtgaggattggaggtctgccttcgat
tccgcatccaacggacccagctcaggcagcgaatcaaggtcaagaagcgctgatggacgc
agagggcgctatgaaaacggcgacgtgacctccggtgccaactccggcagccgacgcact
ccaaaccggttacctccagcacctcctaaatactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345610
Entry
4345610           CDS       T01015                                 
Name
(RefSeq) dynamin-2A
  KO
K01528  dynamin 1/3 [EC:3.6.5.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4345610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4345610
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4345610
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.5  dynamin GTPase
     4345610
Membrane trafficking [BR:osa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Dynamin
    4345610
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    4345610
   RhoA-dependent endocytosis
    4345610
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4345610
SSDB
Motif
Pfam: Dynamin_N Dynamin_M GED PH MMR_HSR1 PH_8 PH_11 KH_7 AIG1
Other DBs
NCBI-GeneID: 4345610
NCBI-ProteinID: XP_015649009
UniProt: Q7EZV4
LinkDB
Position
8:20408221..20418729
AA seq 875 aa
MEAIEELSELADATRQASALLADDDPSEQPAQRRGGSSFLTVVALGNIGAGKSAVLNGLI
GHPVLPTGENGATRAPICVDLQRDASLSSKSIMLQIDSKSQQVSASSLRHSLQDRLTKAG
SFGKGRSEEINVKLCTSTAPPLKLIDLPGIDQRSMDESMIGNYAARNDAILLVIVPALQA
PDVASSRALRIARELDSEGSRTIGVVSKVDQVAEDQRALLAVQALLVNQGPRTAADIQWI
ATIGNSVPIASVQSGVGSESSPETIWKVEVESLKSILLGSPQSKLGREALVDSLAKQIRT
RIKVRLPNLLNGLQGKSQIIQEELAKLGEQMVQSSEGTRVIALGLCREFEDKFLQHITGV
EGGGWKVVASFEGKFPTRIKQLPLDKHFDMKNVKRIVLEADGYQPYLISPEKGLRSLIKG
LLELAKEPSILLVDEVHRVLLDIVSATANATPGLGRYPLFKREVIAIGSAALDGFKDEAK
KMVIALVDMERAFVPPQHFIRLLQRRMERQRHEDELKSRSTKKVSDAEPSKATSPQTQTK
EGSNLQVLGPAGEITAGFLFKKRAKANDWSNRWFVLNERSGKLGYTKKQEERHFRGVINL
EECNLEEVLDEEDPTRSLKDPKKPNVPDIGTPGLIFKITHKVAYKNVLKAHKAIILKAES
MAEKTEWVTKIRSIVDQKGASATSGLPMKQSHSDGSLMSTSKKDGSLDTMLRKPVDPEEE
LKWISQEVRGYVEAVLSSLAANVPKAVVLCQVEKAKEGMLNQLYTSISMRSVERIEELIQ
EDHSVKHRREKIKKQSSLLSKVTRLLRIHDNRSATSNWSNDSAGSDSNPGSSGQSGDEWK
SAFDPSQDVDPSAAGTNTGSRRIPSRMPPPPPQGG
NT seq 2628 nt   +upstreamnt  +downstreamnt
atggaggcgatcgaggagctctcggagctcgccgacgccacgcggcaggcctccgcgctg
ctcgccgacgacgacccgtcggagcagcccgcgcagcggcgcgggggttcctccttcctc
accgtcgtcgcgctcggcaacatcggagcggggaaatccgcggtgctcaatggattgatc
ggccaccccgttctccctaccggggagaatggtgcgacgagggccccaatatgcgtagat
cttcagagagatgcatcactcagcagcaaatccatcatgctgcaaattgacagcaagtcg
cagcaggtttctgccagttccctcaggcattcgctgcaggaccggttaaccaaggccggt
agttttgggaaggggcgatcggaggagataaatgtgaaattatgcacgagcactgcccct
ccattaaaactaattgatttaccggggattgatcagcggagcatggatgaatcaatgatt
gggaactatgctgcacgcaatgatgcaattttgctagttatcgttccagctctacaagca
cctgatgtagcatcttctcgagctctaaggattgccagagaactagattcagaaggtagt
agaactattggtgtcgtaagtaaagttgatcaagtagccgaagaccagagagctcttctt
gctgttcaggccctgcttgtaaaccaaggccctagaactgcagctgacattcagtggata
gctacgattgggaactctgttcctattgcctctgttcagtctggagtaggttctgaatcc
tcaccagaaactatttggaaagttgaagttgaaagccttaaatctatacttcttggatct
ccgcaaagtaaacttggtagggaggctttagttgattcacttgctaagcagataagaaca
cggataaaagttagactcccaaatctcctgaatggtcttcaaggcaagtctcaaataatc
caggaggaattagcaaaacttggagaacagatggtccaaagttcggaaggaactcgggtc
attgctttaggactttgccgggaatttgaggacaaatttcttcaacatattactggtgtt
gagggtggaggttggaaagttgttgcaagctttgaggggaagttcccaaccaggatcaaa
caactccctctggacaagcattttgatatgaaaaatgtgaaaaggattgttcttgaggct
gatggttaccaaccatacctgatatcacctgaaaaaggtttaagatctcttataaaaggt
cttctagaattagcaaaggaaccatcgatactccttgtggatgaggttcaccgtgtattg
ctagatatagtatcagccacagcaaatgccaccccaggacttggcagatatcctctattt
aagcgtgaggtaattgcaattggatctgctgctttagatggctttaaagatgaggctaaa
aagatggtaattgcactagtggatatggaacgagcattcgtgcctccccagcattttatc
cgcttgttgcagagaagaatggaaaggcaacgtcacgaagatgagctgaaaagtcgctca
acaaagaaggtttcagatgcagaacctagcaaagccacaagtccacaaacccaaacaaaa
gaaggatcaaatttacaagtcttaggacctgcaggagaaattactgctggtttccttttc
aaaaaacgtgcaaaagcaaatgactggagtaaccgctggtttgttctaaatgagagaagt
ggaaagcttggttacaccaagaaacaagaggagaggcattttcgaggcgtcatcaatttg
gaggagtgcaatcttgaggaagttttagatgaggaagatcctacgagaagccttaaagat
cctaaaaagccaaatgtgccagatattggaactcctggtctcattttcaagattacccat
aaggttgcttataaaaatgttttaaaagctcacaaggctattatactgaaggctgaaagt
atggcggaaaaaactgaatgggttactaagattaggagcattgttgaccaaaaaggagct
tctgcaacgagtggtttaccaatgaagcaaagccattcggatggttctctaatgtccact
tctaaaaaggatggttctctagacacgatgcttagaaagccagtagatcctgaggaagag
cttaaatggatatctcaagaagtccgtgggtatgtggaagctgttctcagcagtcttgcg
gcaaatgtccccaaggctgtggttctttgccaagttgagaaggcaaaggaaggcatgctt
aatcagctctatacttcgataagcatgcgaagcgtagaaaggattgaagagctaatccag
gaggaccacagtgtgaagcacaggcgtgaaaaaatcaaaaagcaatcatcacttctttcc
aaggttactcgtctgctccgtatccatgataatcgctcagctacttctaattggtcgaat
gattctgctggatcagatagtaatccagggagcagtggccagtctggagacgaatggaaa
tctgcatttgatccatcacaagatgttgatccatctgctgctggaacaaacacggggagc
cgccgcattccgagccgaatgccgccgccacctccacagggtggttga

DBGET integrated database retrieval system