KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330673
Entry
4330673           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha-1, mitochondrial
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330673
   00020 Citrate cycle (TCA cycle)
    4330673
   00620 Pyruvate metabolism
    4330673
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4330673
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 4330673
NCBI-ProteinID: XP_015626335
UniProt: Q6Z5N4
LinkDB
Position
2:complement(30918816..30922959)
AA seq 390 aa
MAAAILLRRVPPARAQATALIAARSISDSTAPLTIETSVPFTSHIVDPPSRDVTTTPAEL
LTFFRDMSVMRRMEIAADSLYKAKLIRGFCHLYDGQEAVAVGMEAAITRSDSIITAYRDH
CTYLARGGDLVSAFAELMGRQAGCSRGKGGSMHFYKKDANFYGGHGIVGAQVPLGCGLAF
AQKYRKEETATFALYGDGAANQGQLFEALNISALWKLPAILVCENNHYGMGTAEWRAAKS
PAYYKRGDYVPGLKVDGMDVLAVKQACKFAKEHAIANGPIVLEMDTYRYHGHSMSDPGST
YRTRDEISGVRQERDPIERVRKLILAHDLATAAELKDMEKEIRKEVDDAIAKAKESPMPD
TSELFTNVYVKGFGVESFGADRKELRATLP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggctgcggccatcctcctccgccgcgtcccccccgcgcgggcccaggccacggcgctc
atcgcggcgcgctcgatctcggactccacggcgccgctcaccatcgagacctcggtcccc
ttcacctcccacatcgtcgacccgccctcgcgcgacgtcaccaccaccccggccgagctc
ctcaccttcttccgcgacatgtccgtgatgcgccggatggagatcgccgcggattccctc
tataaggccaagctcatccgcgggttctgccacctctacgacggccaggaggccgtcgcc
gtcgggatggaggccgccatcacccgctccgattccatcatcaccgcgtaccgcgatcac
tgcacctacctcgcacgcggcggcgacctcgtctccgcgttcgcggagctcatgggccgc
caggctgggtgctcccgcgggaagggcggatccatgcatttctacaagaaggacgccaat
ttctatggtggccacggtatcgtcggcgcccaggttccccttggatgcggtctcgccttc
gcgcagaagtataggaaagaggaaactgctacgtttgccctctatggtgatggtgccgcg
aaccagggccagctctttgaggccctcaatatatcggctctttggaagctgccagctata
ttggtctgcgaaaacaaccattatgggatgggaaccgctgagtggagggcagcaaagagc
cctgcctactacaagcgtggtgattatgtgcctggattgaaggttgatggaatggatgtt
cttgctgtgaagcaggcatgcaaattcgcaaaagagcatgctattgcaaatggcccaatt
gttcttgaaatggatacctacaggtaccatggccattctatgtcagatcccggaagcact
taccgtaccagggatgagatctcaggtgtaagacaggagcgtgatccaattgaaagggtt
aggaagttgattttggctcatgacctagcaactgctgctgagctcaaggacatggagaaa
gaaatcagaaaagaagtcgatgatgccattgcgaaagcaaaggagagtcctatgcctgat
acttctgagctctttacgaatgtatatgtcaagggttttggtgtggagtcatttggggca
gacaggaaggaattgagagctactcttccatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333564
Entry
4333564           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit beta-4, chloroplastic
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4333564
   00020 Citrate cycle (TCA cycle)
    4333564
   00620 Pyruvate metabolism
    4333564
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4333564
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 4333564
NCBI-ProteinID: XP_015631374
UniProt: Q10G39
LinkDB
Position
3:24902339..24905495
AA seq 400 aa
MAAASSLHAAPRVGSSSSFSSSSSAGRRSASAARSVRVAAAAGSCAARRAGGRMVARAAV
ASKAESPASAASSKSDGHEVLLFEALREALIEEMKEDPTVCVFGEDVGHYGGSYKVTKGL
AEMFGDLRVLDTPIAENSFTGMGVGAAMKGLRPVVEGMNMGFLLLAYNQISNNCGMLHYT
SGGQFKIPIVIRGPGGVGRQLGAEHSQRLESYFQSIPGLQMVACSTPYNAKGLMKAAIRS
ENPVVLFEHVLLYNLKEKIPDEEYVLCLEEAEMVRPGEHVTILTYSRMRYHVMQAAKTLV
NKGYDPEVIDIRSLKPFDLHTIGNSIKKTHRVLIVEECMRTGGIGASLRSAIIDNFWDYL
DAPIMCLSSQDVPTPYAAPLEDATVVQPAQIVAAVEQICQ
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcggccgcttcctccctccacgccgccccgcgggtgggatcctcctcctccttctcc
tcctcctcctccgctggccgcagatcagcctccgcggcgaggagcgtgcgcgtggcggcg
gcggccggatcgtgcgcggcgcggcgggcggggggaaggatggtggcgcgggccgccgtt
gcatccaaggcggaatcgccggcgagcgcggcctcctccaagtctgacggtcatgaggtc
ttactgtttgaggctcttcgcgaggccttgatagaagagatgaaagaagatccaacggta
tgtgtctttggtgaagatgtcggtcactatggaggttcttacaaggtgaccaaaggtctg
gctgagatgtttggagacctacgagtccttgatacccctattgctgagaactcattcacc
ggcatgggagttggagcagcgatgaaggggttgaggcctgttgttgaaggaatgaacatg
ggtttccttctccttgcttacaaccaaatctcaaacaactgcggaatgcttcactacacc
tctggtggccagttcaaaatcccaatcgtgatccgaggtcctggtggagttggtcgccag
cttggtgctgagcactcccagcgtctggagtcttactttcagtcgatccccggcctccag
atggttgcttgctctaccccttacaacgccaagggtctgatgaaagccgccataaggagc
gagaaccccgtggtgctattcgagcacgtccttctgtacaacctgaaggagaaaattccc
gacgaggaatatgttctatgcctggaggaggctgagatggtgcgtcccggagaacatgtt
accatcctcacatactcgcggatgaggtaccatgtgatgcaggctgcgaagaccctggtg
aacaaagggtatgatcccgaggtcatcgacatcaggtcgttgaagccatttgacctgcac
accataggcaactctatcaagaagacccaccgcgtgctgattgtggaggagtgcatgcgc
acgggcgggatcggcgccagcttgagatcggccatcatcgacaacttctgggactacctt
gacgcacccatcatgtgcttgtcgtcgcaggatgtgccgacgccgtatgctgcgcctctg
gaggatgccaccgtcgtgcagcctgcccagattgtggctgccgttgagcaaatatgccag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334968
Entry
4334968           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4334968
   00020 Citrate cycle (TCA cycle)
    4334968
   00620 Pyruvate metabolism
    4334968
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4334968
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Other DBs
NCBI-GeneID: 4334968
NCBI-ProteinID: XP_015636508
UniProt: Q7XTJ3
LinkDB
Position
4:1135884..1139712
AA seq 425 aa
MAAASSFTAAAKFLAPVSARSAGDYKPPLPLPASASLRPGRKPAPRLRTALAVSSDVLPG
NKAAPAAAAHSAVTREEALELYEDMVLGRIFEDMCAQMYYRGKMFGFVHLYNGQEAVSTG
FIKLLNQADCVVSTYRDHVHALSKGVPARSVMAELFGKATGCCRGQGGSMHMFSEPHNLL
GGFAFIGEGIPVATGAAFAAKYRHEVLKQSSPDGLDVTLAFFGDGTCNNGQFFECLNMAQ
LWKLPIVFVVENNLWAIGMSHLRATSDPEIYKKGPAFGMPGVHVDGMDVLKVREVAKEAI
ERARRGEGPTLVECETYRFRGHSLADPDELRRPDEKSHYAARDPITALKKYIIEQNLATE
SELKSIEKKIDDVVEEAVEFADASPLPPRSQLLENVFSDPKGFGIGPDGKYRCEDPLFTQ
GTAQV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggccgccgcgtcctccttcaccgccgccgccaagttcttggcgccggtgtccgcgaga
tccgccggggactacaagccgccgctcccgctcccggcctccgcctccctcaggcccggg
aggaagcccgcgccccgcctccgcaccgcgctcgccgtctcctccgacgtgctccccggg
aacaaggccgcccccgccgccgccgcccactccgctgtcacgcgggaagaggctttggag
ctgtacgaggacatggttcttggccgtattttcgaggatatgtgcgcgcaaatgtactac
cgtggcaagatgtttggttttgtccatttatacaatgggcaagaagctgtctccactggc
ttcatcaagctgctcaaccaagctgactgtgttgtcagcacataccgtgaccacgtccat
gccctatccaagggtgtccctgcacgttctgtcatggctgagcttttcggtaaggccact
ggctgctgccgtggacaaggtggttctatgcacatgttctctgaaccccacaacctcctt
ggaggttttgccttcatcggagagggcatccctgttgctactggtgctgcctttgctgct
aaataccgccatgaggtgctcaagcagtctagccctgatggacttgatgtaaccctggca
ttctttggtgatggtacctgtaacaatggccaattctttgagtgcctgaacatggctcag
ctttggaagcttcctattgtgtttgttgtggagaacaatctatgggcaattgggatgtcg
catcttagggctacttcagacccagagatttataagaagggtccagcgtttggaatgccc
ggcgtgcatgttgatgggatggatgtcctgaaggtcagggaggtggctaaggaggccatt
gagagggcaaggagaggtgaaggaccgactcttgtggagtgtgagacttaccggttcaga
gggcattctcttgctgatccagatgagctcaggagacctgatgagaaatctcattacgcc
gcaagggaccccattacagccttgaagaagtacatcatcgaacagaaccttgcaactgaa
tccgagctgaagagcatcgagaaaaagatcgatgatgttgttgaagaggccgtggagttc
gctgacgcaagcccgctccctccccggagccagcttctggaaaacgtgttctcagatccc
aagggctttggaattggccctgacgggaagtaccggtgtgaggatcccttgttcacgcaa
ggcacggcccaagtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340640
Entry
4340640           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4340640
   00020 Citrate cycle (TCA cycle)
    4340640
   00620 Pyruvate metabolism
    4340640
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4340640
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 4340640
NCBI-ProteinID: XP_015641790
UniProt: Q654V6
LinkDB
Position
6:7602369..7605777
AA seq 398 aa
MAAAVVLLRRLRGVTAAPRRAAAALPLTTSVRGVSDSTEPLTIETSVPYKSHIVDPPPRE
VATTARELATFFRDMSAMRRAEIAADSLYKAKLIRGFCHLYDGQEAVAVGMEAATTRADA
IITAYRDHCAYLARGGDLAALFAELMGRRGGCSRGKGGSMHLYKKDANFYGGHGIVGAQV
PLGCGLAFAQRYRKEAAVTFDLYGDGAANQGQLFEALNMAALWKLPVVLVCENNHYGMGT
AEWRASKSPAYYKRGDYVPGLKVDGMDVLAVKQACKFAKQHALENGPIILEMDTYRYHGH
SMSDPGSTYRTRDEIAGIRQERDPIERVRKLLLAHDFATTQELKDMEKEIRKQVDTAIAK
AKESPMPDPSELFTNVYVNDCGLESFGVDRKVVRTVLP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggccgcggccgtcgtcctcctccgccgcctgcgcggcgtcacggcggcgccccggcgc
gcggcggcggcgctgcccctgaccacgagcgtccggggtgtctccgattcgacggagccg
ctcaccatcgagacctcggtcccctacaagtcccacatcgtggacccgcccccgcgcgag
gtggccaccacggcgcgcgagctcgccaccttcttccgcgacatgtccgccatgcgccgc
gcggagatcgcggcggactcgctgtacaaggcgaagctgatccgcggcttctgccacctc
tacgacggacaggaggccgtcgcggtgggcatggaggcggccaccacccgcgccgacgcc
atcatcacggcctaccgcgaccactgcgcctacctcgcccgcggcggcgacctcgccgcc
ctcttcgccgagctcatgggccgccgcggcgggtgctccagggggaaaggcgggtcgatg
cacctgtacaagaaggacgccaacttctatggcggccatggcatcgtgggcgcgcaggtg
ccgctcggatgcggcctcgcgttcgcgcagaggtacaggaaggaggccgccgtcacgttc
gacctctacggcgacggcgccgccaaccaggggcagctgttcgaggcgctcaacatggcg
gcgctctggaagctgcccgtcgtgctcgtctgcgagaacaaccactatgggatggggacg
gcggaatggagggcatcgaaaagccccgcatactacaaacgcggcgactatgtgccagga
ttgaaggtcgatggtatggatgttcttgcagtcaaacaagcttgtaaatttgccaagcaa
catgctcttgaaaatggaccgattattcttgagatggacacctacagataccacggacac
tctatgtcagatccagggagcacttaccgcaccagagatgaaattgcaggcataagacag
gagcgcgatccaattgaaagggttaggaagctactactggcccatgactttgcaaccaca
caagaactcaaggacatggagaaagaaataaggaagcaagtcgacactgccatcgcgaaa
gcaaaggaaagtccaatgcccgatccatctgagctctttacaaatgtatatgttaatgac
tgcggtttggagtcatttggtgtggacaggaaggtggtgagaactgtacttccctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346159
Entry
4346159           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4346159
   00020 Citrate cycle (TCA cycle)
    4346159
   00620 Pyruvate metabolism
    4346159
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4346159
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Other DBs
NCBI-GeneID: 4346159
NCBI-ProteinID: XP_015650909
UniProt: Q6Z1G7
LinkDB
Position
8:26777954..26783272
AA seq 374 aa
MLGIARRRLGSGCALGQLMQALRPAAAAAAARTYSAAAKEMTVREALNSALDEEMSADPS
VFLMGEEVGEYQGAYKISKGLLDKYGPDRVLDTPITEAGFTGIGVGAAYQGLRPVVEFMT
FNFSMQAIDHIINSAAKSNYMSAGQINVPIVFRGPNGAAAGVGAQHSQCYAAWYAHVPGL
KVLTPYSAEDARGLLKAAIRDPDPVVFLENELLYGESFPVSAEVLDSSFCLPIGKAKIEQ
EGKDVTITAFSKMVGYALQAAEILSKEGISAEVINLRSIRPLDRATINASVRKTNRLVTL
EEGFPQHGVGAEICMSVVEDSFEYLDAPVERIAGADVPMPYAANLERMAVPQVEDIVRAA
KRACYRAVPMAATA
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgctgggcatcgcgaggaggcgcctcggatccggatgcgcgctggggcaactcatgcag
gcgctccgaccggccgccgccgccgccgcggcgaggacctactccgccgccgccaaggag
atgactgtgcgtgaagcattgaattctgcccttgatgaggagatgtctgctgacccttct
gttttcttgatgggagaagaggttggagaataccaaggggcatataagatatcgaagggt
ttgttagacaaatatggccctgatagggttcttgacacaccaatcacagaggctggtttt
actggaattggtgttggtgctgcctatcaaggtcttcgccctgtggttgagttcatgaca
tttaacttctctatgcaggcaattgatcacatcataaattcagctgccaagtcgaactac
atgtcagctggtcagataaacgttcctattgtttttagagggccaaacggtgctgctgct
ggtgttggtgctcagcactctcagtgttatgcggcttggtatgcgcatgtaccaggattg
aaggtcctaactccttattctgcagaagatgctcggggcttgctaaaagcagcaatcagg
gatccagaccctgttgttttcttggaaaatgaactgctctatggtgaatcattccctgtt
tctgcggaagttcttgattctagcttctgtcttccgattgggaaggctaagatagagcaa
gaaggaaaagatgttacaattaccgcattctccaagatggtcggatatgctcttcaggct
gcagagatactttccaaggagggaatcagtgctgaggtgatcaatcttcggtcaattagg
ccattggatagagctactatcaatgcatcagttaggaaaaccaacagattggtaaccctt
gaagaaggatttccacaacatggggttggcgctgaaatatgcatgtctgttgtagaggac
agctttgaatatcttgatgcgccagttgagaggattgctggagctgatgtgcccatgccc
tacgctgccaaccttgagaggatggctgttccacaggttgaggacattgttcgtgcagcg
aagcgagcctgctacagagcagtaccaatggcagcaacagcctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347531
Entry
4347531           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit beta-2, mitochondrial
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347531
   00020 Citrate cycle (TCA cycle)
    4347531
   00620 Pyruvate metabolism
    4347531
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4347531
SSDB
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Other DBs
NCBI-GeneID: 4347531
NCBI-ProteinID: XP_015612322
UniProt: Q0J0H4
LinkDB
Position
9:19752705..19759003
AA seq 376 aa
MLGAARRQLGSGPMLGQVLRRLRPATAAAADAARAYSAAAKEMTVREALNSALDEEMSAD
PSVFLMGEEVGEYQGAYKISKGLLDKYGPERVLDTPITEAGFTGIAVGAAYQGLRPVVEF
MTFNFSMQAIDHIINSAAKSNYMSAGQISVPIVFRGPNGAAAGVGAQHSQCYAAWYAHVP
GLKVLVPYSAEDARGLLKAAIRDPDPVVFLENELLYGESFPISAEVLDSSFALPIGKAKI
EREGKDVTITAYSKMVGYALQAADILSKEGISAEVINLRSIRPLDRATINASVRKTNRLV
TIEESFPQHGIGAEICMSVVEESFEYLDAPVERIAGADVPMPYAANLERMAVPQVDDIVR
AAKRACYRAVPMAATA
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgctgggcgccgcgaggaggcagctcggatccggccccatgctggggcaggtgctgcgg
aggctccggccggcgacggcggctgcagcggatgcggcgagggcgtactccgcggcggcg
aaggagatgactgtccgtgaagcgctgaactctgcactcgatgaagaaatgtctgctgat
ccttctgtttttctgatgggtgaagaggtgggagagtatcaaggtgcatacaagatttca
aagggcttgcttgacaagtatggtcctgagagggttctggatacaccaatcacagaggct
gggtttactggcattgctgttggtgcagcgtatcaaggtcttcgacctgttgtagagttc
atgacattcaatttctcaatgcaggcaattgatcatatcatcaattcagctgccaagtca
aactacatgtcagcgggtcagatatctgtccctattgttttcagaggacctaatggagct
gctgctggagttggcgctcaacactcgcagtgttatgcggcttggtatgcacatgttccg
ggtcttaaggttctggttccatattctgcagaagatgctcgtggcttgctcaaagctgcg
attagggatccggaccctgttgttttcttggaaaatgaactgctctatggagaatcattc
cctatttctgctgaagtgcttgattctagtttcgctctgccaattggcaaagcaaagata
gagcgtgagggtaaagatgttacaattactgcatactccaagatggttggatatgctctt
caggccgcagatatattgtccaaagaaggaatcagtgctgaggtgataaaccttcgttca
attagaccacttgatagagctactatcaatgcatctgttagaaaaacaaatagattggtg
accattgaggaaagcttcccacagcatgggattggtgctgagatatgcatgtctgttgtt
gaggaaagctttgaatatcttgatgcaccagttgagagaattgctggagctgatgtaccc
atgccctatgctgccaatcttgagaggatggctgtcccacaggttgacgatattgtccgt
gcagcgaagcgtgcgtgctacagagcggtgcccatggcagcaactgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352803
Entry
4352803           CDS       T01015                                 
Name
(RefSeq) pyruvate dehydrogenase E1 component subunit beta-3, chloroplastic
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4352803
   00020 Citrate cycle (TCA cycle)
    4352803
   00620 Pyruvate metabolism
    4352803
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     4352803
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 4352803
NCBI-ProteinID: XP_015620613
UniProt: Q2QM55
LinkDB
Position
12:26200224..26203493
AA seq 391 aa
MATAAAASLQYALHGAASASAKPRSAAPGRSVRVVAARRSVRARGGAVVARAAVTASADA
TAESKSGGHEVLLFEALREALIEEMKEDPTVCVFGEDVGHYGGSYKVTKGLAEMFGDLRV
LDTPIAENSFAGMGVGAAMKGLRPIVEGMNMGFLLLAYNQISNNCGMLHYTSGGQFKIPI
VIRGPGGVGRQLGAEHSQRLESYFQSIPGLQMVACSTPYNAKGLMKAAIRSENPVVLFEH
VLLYNLKEKIPDEEYICCLEEAEMVRPGEHVTILTYSRMRYHVMQAAKTLVNKGYDPEVI
DIRSLKPFDLHTIGNSIKKTHRVLIVEECMRTGGIGASLRSAIIDNFWDYLDAPIMCLSS
QDVPTPYAATLEDATVVQPAQIVAAVEQICQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggccaccgctgccgccgcctcgctgcagtacgcgctgcacggcgccgcctccgcctcc
gccaagcccagatccgccgcgccaggcaggagcgtgcgcgtggtcgcggcgaggaggtcg
gtgcgggcgcgcggaggggcggtggtagcgcgcgccgcggttacagcgagtgcggatgcg
acggcggaatccaagtccggcggtcatgaggtcctgttgtttgaggcccttcgagaagca
ttgatagaagagatgaaagaagatcctacagtttgtgtatttggtgaagatgttggtcac
tatggaggttcatataaggtgaccaagggcttggctgagatgtttggagaccttcgggtt
cttgatacccctattgctgagaattctttcgctggcatgggagttggagcagcaatgaag
gggctaaggccaattgttgaaggcatgaacatgggtttccttctccttgcttacaatcag
atctcaaacaattgtggtatgcttcattatacctcaggtggccagttcaagatcccgatt
gtgattcgaggccctggtggtgttggtcgccagcttggtgctgagcattcacaacgtctc
gaatcgtacttccagtccattcctggacttcaaatggttgcttgctctactccttacaat
gctaagggcctgatgaaggctgccataaggagtgagaaccctgtggtgctgttcgagcat
gtccttctgtacaacctgaaggagaagatccctgatgaggaatacatttgctgcttggag
gaggccgagatggtacgtccaggtgagcatgtgaccatcctcacgtactctcgcatgagg
taccatgtgatgcaggcagccaagacactggtgaacaaagggtacgatccggaggtcatt
gatatcaggtcgctgaaaccattcgatctgcacacgatagggaactccattaagaagacc
caccgcgttctgattgtggaggagtgcatgcgaacgggtggtatcggcgccagcctgagg
tcggccatcattgataacttctgggactaccttgatgcccccatcatgtgcttgtcatca
caggatgtaccgacgccatatgctgcaactctggaggacgcaaccgtcgtgcagcctgcc
caaattgtggccgctgtcgagcagatctgccaataa

DBGET integrated database retrieval system