KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330720
Entry
4330720           CDS       T01015                                 
Name
(RefSeq) cullin-3A
  KO
K03869  cullin 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4330720
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4330720
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330720
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     4330720
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     4330720
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 WAC_Acf1_DNA_bd RPA_C Glyco_hydro_68
Other DBs
NCBI-GeneID: 4330720
NCBI-ProteinID: XP_015626686
UniProt: Q6YWY5 Q6ZGT3
LinkDB
Position
2:complement(31309882..31312910)
AA seq 736 aa
MSGGGPPKKRNFKIELFKHRVELDPKYAERTWKVLEHAIHEIYNHNASGLSFEELYRSAY
NMVLHKYGEKLYDGLERTMTWRLKEISKSIEAAQGGLFLEELNAKWMDHNKALQMIRDIL
MYMDRTYVPQSRRTPVHELGLNLWRDHIIHSPMIHSRLLDTLLDLIHRERMGEMINRGLM
RSITKMLMDLGAAVYQDDFEKPFLDVTASFYSGESQEFIECCDCGNYLKKSERRLNEEME
RVSHYLDSGTEAKITSVVEKEMIANHMHRLVHMENSGLVNMLVDDKYDDLARMYNLFRRV
FDGLSTIRDVMTSYLRETGKQLVTDPERLKDPVEFVQRLLNEKDKHDKIINVAFGNDKTF
QNALNSSFEYFINLNNRSPEFISLYVDDKLRKGLKGATEEDVEVILDKVMMLFRYLQEKD
VFEKYYKQHLAKRLLSGKTVSDDAERSMIVKLKTECGYQFTSKLEGMFTDMKTSQDTMID
FYAKKSEELGDGPTLDVHILTTGSWPTQPCPPCNLPTEILAICDKFRTYYLGTHSGRRLT
WQTNMGTADIKATFGKGQKHELNVSTYQMCVLMLFNSTDGLTYKDIEQDTAIPASDLKRC
LQSLACVKGKNVLRKEPMSKDISEDDTFYFNDKFTSKLVKVKIGTVVAQKESEPEKQETR
QRVEEDRKPQIEAAIVRIMKSRRVLDHNSIVAEVTKQLQARFMPNPVVIKKRIESLIERE
FLERDKADRKLYRYLA
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgagcgggggcgggccgccgaagaaacgcaacttcaagatcgagctgttcaagcaccgc
gtggagctcgaccccaagtacgcggagcggacatggaaggtcctggagcacgccatccac
gagatctacaaccacaacgccagtggcctctccttcgaggagctctacaggagtgcctac
aacatggtgctccacaagtatggtgagaagctatatgatggcctggagagaactatgaca
tggcgcttgaaggaaatatcaaaatcaatagaggctgcacagggtggtttgtttctggag
gagctgaatgccaagtggatggatcacaataaggcattgcagatgatccgagatattcta
atgtacatggatcgaacatatgtcccgcaatcccgtagaacacctgttcatgagcttggt
ttgaatttgtggagggatcacataattcactctcccatgattcatagtcggctgcttgat
acccttctggatcttattcacagggagagaatgggtgaaatgattaacagaggcctgatg
aggagcataacgaaaatgttaatggatcttggtgctgctgtatatcaagatgactttgag
aagccgtttttggatgttacagctagcttctacagtggagagtctcaggagttcattgag
tgctgtgactgtgggaactatcttaagaagtccgagagacgtctcaatgaggaaatggaa
cgtgtctcacactacttggattctggcactgaggcaaagataactagtgtggttgagaaa
gaaatgattgccaatcacatgcatagattggttcatatggaaaactcaggccttgtaaat
atgcttgtagatgacaaatatgacgacttggctaggatgtacaacttattccgaagggtt
tttgatgggctatcgacaatcagagatgtgatgacttcatacctaagggaaacagggaag
cagttagtgacagatcctgagaggttgaaagacccagtggaatttgttcagcgcttgtta
aatgagaaggacaagcatgataagatcatcaacgttgcttttggcaatgacaaaactttc
cagaatgctctaaattcatcctttgagtacttcatcaacttaaacaacaggtcacctgaa
ttcatatcgttgtatgttgatgataaacttcggaaaggattgaaaggagccacagaagag
gatgtggaggttattctggacaaagtcatgatgctgtttcggtacctccaggagaaggat
gtatttgagaagtactacaagcagcatttggcgaaaagactattgtctggcaaaactgtt
tctgatgatgctgagaggagtatgatagttaaactcaagacagaatgtgggtaccagttc
acttccaaattagagggcatgttcactgacatgaagacctctcaggacactatgatagac
ttttatgccaagaagtctgaggaacttggcgatggcccaacacttgatgtccacattctt
acaactggttcttggccaacacagccctgccctccctgcaaccttccaactgaaatcctt
gcaatatgtgataagttccggacatactaccttggaactcacagtggccggagattgaca
tggcaaacaaacatgggaacagctgacataaaagccacatttgggaaaggtcagaagcat
gaactaaatgtatccacttatcagatgtgtgttctcatgctgtttaattctaccgatggg
ttaacctacaaagacatcgaacaagatactgcgatacctgcctcggatctaaagagatgc
cttcaatctcttgcttgtgtcaaggggaagaatgttctccgcaaggaacccatgagcaaa
gatatatcggaggatgacacattctacttcaacgacaagttcacaagcaagcttgttaag
gtcaagattgggacagtagtggcgcaaaaggaatctgagccagagaaacaagagactcgt
caacgggttgaggaggacaggaaacctcaaattgaggctgctatcgtcaggattatgaaa
tccaggagggtcttggatcataacagcattgtagctgaggttaccaagcaattgcaagcc
cgattcatgccgaatcctgttgtcataaagaaacgcatagaatctctaattgagcgtgaa
ttcttagagagggacaaagcagataggaagttatatcgctatcttgcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337175
Entry
4337175           CDS       T01015                                 
Name
(RefSeq) cullin-3B
  KO
K03869  cullin 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4337175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337175
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337175
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     4337175
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     4337175
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 4337175
NCBI-ProteinID: XP_015636933
UniProt: A0A5S6RCD4
LinkDB
Position
4:32726323..32730768
AA seq 731 aa
MNSQKKRSPKIEPFRHRVDADPKSFDKSWKKLEDAIREIYNHNASGLSFEELYRTAYNLV
LHKHGLKLYDKLTENLKGHLKEMCRSIEDAQGSLFLEELQRRWADHNKALQMIRDILMYM
DRTFIATNKKTPVFDLGLELWRDIVVRTPKIHGRLLDTLLELIHRERMGEMINRGLMRST
TKMLMDLGSSVYHDDFEKPFLEVSASFYSGESQQFIECCDCGEYLKKAERRLAEELERVS
QYMDAKTADKITSVVDTEMLANHMQRLILMENSGLVNMLVDDKHEDLSRMYNLFKRVPDG
HSTIRSVMASHVKESGKALVSDPEKIKDPVEFVQRLLNEKDKYDEIISISFSNDKAFQNA
LNSSFENFINLNNRSPEFISLFVDDKLRKGVKGANEEDVETVLDKVMMLFRYLQEKDVFE
KYYKQHLAKRLLSGKTTSDEAERSMLVKLKTECGYQFTSKLEGMFNDLKTSHDTMQSFYA
NLSGDTDSPTISVQILTTGSWPTQPCTPCKLPPEIVDISEKFRAFYLGTHNGRRLTWQTN
MGNADIKATFGGRRHELNVSTYQMCVLMLFNSADGLTYGDIEQATGIPHADLKRCLQSLA
CVKGKNVLRKEPMSKDISEDDTFYYNDKFTSKLVKVKIGTVVAQKETEPEKLETRQRVEE
DRKPQIEAAIVRIMKSRRVLDHNSIITEVTKQLQSRFLPNPVVIKKRIESLIEREFLERD
KVDRKMYRYLA
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgaactcgcagaagaagcgcagccccaagatcgagcccttccggcaccgcgtggatgcg
gacccaaagtccttcgacaaatcgtggaagaagctcgaggacgccatccgcgagatttac
aaccacaacgccagcggcctctccttcgaggagctgtacaggactgcttataacttggtt
cttcacaagcatggtctgaagctatatgataaactcacagagaatttaaaaggacacctg
aaagaaatgtgcagatcaatagaggatgcccaaggtagtttgtttctggaggaactgcag
agaagatgggctgatcacaataaggcactacaaatgatcagagatatactcatgtatatg
gataggacatttattgcaactaacaaaaagacacctgtctttgaccttggtctagagttg
tggagagatatcgttgtccgcactcccaaaattcatgggaggttgcttgacacactcctt
gaactcattcatagagagaggatgggtgagatgataaacagaggtctgatgaggagtacc
accaaaatgttgatggatctagggtcttctgtctatcatgatgactttgagaagccattc
cttgaggtatccgcaagtttctatagtggtgagtcacaacagttcattgagtgctgtgat
tgtggcgaatatctcaagaaagctgagagacggcttgctgaagagttggagcgtgtttct
cagtatatggatgccaaaaccgcagacaaaataactagtgttgtggacactgagatgctt
gcaaatcacatgcagcggttgattcttatggagaattctggtcttgtgaatatgcttgtt
gatgacaaacatgaagaccttagcaggatgtacaacttgtttaaacgtgttcctgatggg
cattcaacaattagatctgtgatggcctctcatgttaaggaaagtggaaaggcattggta
tctgacccagagaagataaaggaccctgttgagtttgtccagcgtcttctaaatgagaaa
gacaagtatgatgagatcataagtatttcattcagcaatgacaaggctttccaaaatgct
ctgaattcctccttcgagaatttcatcaacttgaacaaccgatctcctgaattcatttcg
ctgtttgttgatgacaagctccggaaaggggtgaaaggggccaatgaagaggatgttgaa
actgtcttggacaaggtgatgatgctcttcagatatttgcaggagaaagatgtttttgag
aaatattacaagcaacacttggccaaacgtcttctatctgggaaaactacttctgatgaa
gctgagaggagtatgcttgtgaagctgaagacggaatgtggctaccagtttacgtcaaaa
ttggaaggcatgttcaatgatctgaagacatcgcatgatactatgcaaagtttttatgct
aatctctctggtgatactgatagcccaacaatatcagtccagatactcaccactgggtct
tggccaacacagccatgtaccccctgcaaacttccacctgaaattgttgatatatctgag
aaattccgggcattctaccttggcacccacaatggcaggagattgacatggcaaacaaac
atggggaatgcagatatcaaagcaacgttcggaggccgcaggcatgagttgaatgtctcg
acatatcagatgtgtgtcctgatgctgtttaattcagcagatggcttgacttacggtgac
attgagcaggccacaggtataccacatgctgatctgaaacgctgcctccagtctcttgct
tgtgttaagggtaagaatgtgctgcggaaggaacccatgagcaaggatatatctgaagat
gacactttctactacaatgacaagttcacaagcaagttggtcaaggtgaagattggcacc
gtggttgctcagaaagaaacagaaccagagaagttggaaactcgccagagagttgaggaa
gacaggaaacctcaaattgaggctgcaattgtcagaatcatgaagtccagaagagtcttg
gaccacaatagcataatcacggaggtgacaaagcagcttcaatcgcgctttttgccaaat
cctgttgtgataaagaaaagaatagagtccctgatcgagagggagttcttggagagggac
aaggtagataggaagatgtaccgttatcttgcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344771
Entry
4344771           CDS       T01015                                 
Name
(RefSeq) cullin-3A
  KO
K03869  cullin 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4344771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4344771
   03400 DNA repair and recombination proteins [BR:osa03400]
    4344771
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     4344771
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     4344771
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 HisK_sensor
Other DBs
NCBI-GeneID: 4344771
NCBI-ProteinID: XP_015650664
UniProt: A3BQ28 Q6YYL1
LinkDB
Position
8:complement(4153336..4157284)
AA seq 731 aa
MSSRKKPSRIEPFRHKVETDPRFFEKAWRKLDDAIREIYNHNASGLSFEELYRTAYNLVL
HKHGPKLYDKLTENMEDHLQEMRVSIEAAQGGLFLVELQRKWDDHNKALQMIRDILMYMD
RVFIPTNKKTPVFDLGLDLWRDTIVRSPKIHGRLLDTLLDLIHRERTGEVINRSLMRSTT
KMLMDLGSSVYQDDFERPFLEVSASFYSGESQKFIECCSCGEYLKKAQQRLDEEAERVSQ
YMDAKTDEKITAVVVKEMLANHMQRLILMENSGLVNMLVEDKYEDLTMMYSLFQRVPDGH
STIKSVMNSHVKETGKDMVMDPERLKDPVDFVQRLLNEKDKYDSIVTTSFSNDKSFQNAL
NSSFEHFINLNNRCPEFISLYVDDKLRKGMKEANEEDVETVLDKVMMLFRYLQEKDLFEK
YYKQHLAKRLLSGKAASDDSERSMLVKLKTECGYQFTSKLEGMFNDLKTSHDTTQRFYAG
TPDLGDAPTISVQILTTGSWPTQPCNTCNLPPEILGVSEMFRGFYLGTHNGRRLTWQTNM
GTADIKAVFGNGSKHELNVSTYQMCVLMLFNSADCLSYRDIEQTTAIPSADLKRCLQSLA
LVKGKNVLRKEPMSRDISDDDNFYVNDKFTSKLFKVKIGTVATQKESEPEKMETRQRVEE
DRKPQIEAAIVRIMKSRRVLDHNSIVTEVTKQLQPRFMPNPVVIKKRVESLIEREFLERD
KTDRKLYRYLA
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgagttccaggaagaagccgtcgaggatcgagccgttcaggcacaaggtggagacggac
ccgaggttcttcgagaaggcgtggaggaagctcgacgacgccatccgcgagatctacaac
cacaacgccagcggcctctccttcgaggagctctacaggactgcttataatctggtactt
cacaaacatgggccaaagctctatgacaaactgacagaaaacatggaagatcacctgcaa
gaaatgcgcgtatcgattgaggctgctcaaggtggtttgttcttggtagaactacagagg
aaatgggatgaccataacaaggctttgcaaatgatcagagatatcctgatgtacatggac
agggtttttattcccaccaataaaaagacacctgtatttgatcttggattggatctttgg
agagatactattgttcggtcacccaagatccatggaaggttgcttgacactcttcttgat
ctcatacatagagagagaacaggtgaggtgataaacagatccttgatgaggagtacaact
aaaatgttgatggatctaggttcttctgtttatcaggatgattttgaaaggccattcctt
gaggtgtctgctagtttttatagtggtgagtcacaaaaattcatagagtgttgttcctgt
ggtgaatatcttaagaaggctcagcagcggcttgatgaagaagcggaacgtgtttcacag
tacatggatgccaaaacagacgagaaaataactgctgttgtggtgaaggaaatgcttgcg
aatcacatgcagaggttgattcttatggagaactcaggtcttgttaatatgcttgtggag
gacaagtatgaagacctgaccatgatgtacagcttgtttcaacgtgttcccgatggtcac
tcgacaattaaatctgtgatgaattcacatgttaaagaaaccgggaaggatatggtaatg
gatcctgagaggctgaaggaccctgttgattttgtccagaggcttctaaatgagaaggat
aagtatgacagtattgttaccacttcctttagcaatgacaagagtttccaaaatgctctg
aattcctcctttgagcacttcattaacttaaacaatagatgccctgagttcatctcgctg
tatgttgacgacaaactgcgtaaaggaatgaaagaggccaatgaggaggatgttgagact
gtcctggacaaagtgatgatgctgtttaggtacttgcaagaaaaagatttgtttgagaaa
tactacaagcaacacttggcgaagcgccttctttctgggaaggctgcttctgatgattct
gagagaagtatgcttgtgaagctcaagacagaatgtggatatcagttcacttcaaaattg
gagggcatgttcaatgatttgaagacctctcatgataccacacagcgattttacgctggt
actcctgatttgggggatgcccctactatatctgtccagatactcaccactgggtcttgg
cccacacaaccatgtaacacctgcaaccttcctcctgagattcttggcgtgtccgagatg
tttcggggtttctaccttggtacccacaatggcaggagactgacatggcaaacaaacatg
ggtactgcagacatcaaagcagtgtttggaaatggcagcaagcacgagctaaacgtgtcg
acctaccagatgtgtgttctcatgttgttcaactcggcggactgtttgtcttaccgtgat
atcgagcagactacagcgataccatccgcggacctgaagcgctgccttcagtctctcgcg
cttgtgaagggcaagaacgttctgcgcaaggaacctatgagcagggacatctccgacgat
gacaacttctacgtcaacgataagttcaccagcaagctgttcaaggtgaagatcggcacg
gtggcgacacagaaggagtctgagccagagaagatggagacccggcagagagtcgaggag
gacaggaagcctcagatcgaggcggccatcgtgaggatcatgaagtcgaggagagtgctg
gatcacaacagcatagtgacagaggtgacgaagcagctgcagcctcgtttcatgccgaac
cctgtggtgatcaagaagagagtcgagtctctgattgagcgcgagttcttggagagggac
aagacagacaggaaactgtaccggtatcttgcataa

DBGET integrated database retrieval system