KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330732
Entry
4330732           CDS       T01015                                 
Name
(RefSeq) shikimate kinase 1, chloroplastic
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4330732
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     4330732
SSDB
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 CoaE dNK Cytidylate_kin Ploopntkinase3 APS_kinase ABC_tran AAA_29
Other DBs
NCBI-GeneID: 4330732
NCBI-ProteinID: XP_015626759
UniProt: Q5NTH4
LinkDB
Position
2:31491672..31494351
AA seq 308 aa
MEAGVGLALQSRAAGFGGSDRRRSALYGGEGRARIGSLRVAEPAVAKAAVWARGSKPVAP
LRAKKSSGGHETLHNSVDEALLLKRKSEEVLFYLNGRCIYLVGMMGSGKSTVGKIMSEVL
GYSFFDSDKLVEQAVGMPSVAQIFKVHSEAFFRDNESSVLRDLSSMKRLVVATGGGAVIR
PVNWKYMKKGLSVWLDVPLDALARRIAKVGTASRPLLDQPSGDPYTMAFSKLSMLAEQRG
DAYANADVRVSLEEIASKQGHDDVSKLTPTDIAIESFHKIENFVIEHTVDNPVGDSQADS
RAQRIQTL
NT seq 927 nt   +upstreamnt  +downstreamnt
atggaggcgggcgtggggctggcgctgcagtcgcgggcggcggggttcggcggctccgac
cgccgccggagcgcgctctacggcggcgaggggcgggcgcggatcgggagcttgagggtc
gctgagccggcggtggcgaaggccgctgtgtgggctcgcgggtccaagccggtcgccccg
ctccgtgccaagaaatcgtccggaggtcatgaaacattgcataactcggttgatgaagcc
ctcttgctaaagagaaaatcagaagaagttctcttctatttgaatggacggtgtatttac
ctagttggaatgatgggttctggaaaaagtactgtgggaaagatcatgtctgaagttttg
ggttattcgttctttgatagtgataaattggtcgaacaagctgtgggcatgccttcagtc
gctcaaattttcaaggttcatagtgaagccttctttagggataatgagagtagtgtcttg
agggatttgtcctcaatgaagcgattagttgttgctactggaggtggtgctgttatccga
ccagttaactggaaatacatgaagaagggcctatctgtttggttggatgtgcccttggac
gctcttgctaggcgtattgctaaagtggggactgcctcccgtcctcttctagatcaacca
tctggtgatccatacacaatggctttttctaaactcagcatgctcgcggagcaaaggggc
gatgcttatgcaaatgctgatgtgagggtttctcttgaagagattgcatctaaacagggt
catgatgatgtatcgaagctaacaccaactgacattgctattgagtcgtttcataagatc
gagaactttgtcattgaacataccgttgacaatccggttggtgactcccaggctgactca
cgtgctcagaggatacagaccttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337165
Entry
4337165           CDS       T01015                                 
Name
(RefSeq) shikimate kinase 3, chloroplastic
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4337165
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     4337165
SSDB
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 CoaE dNK TsaE Cytidylate_kin AAA AAA_24 AAA_17 Ploopntkinase3 tRNA_lig_kinase AAA_16 APS_kinase AAA_22
Other DBs
NCBI-GeneID: 4337165
NCBI-ProteinID: XP_015636368
UniProt: Q7X7H9
LinkDB
Position
4:complement(32582186..32585719)
AA seq 287 aa
MDAGVGLRAKPGAWAGLGNPRRSSTARVPVRFAVEKFAQPLVLGSDRRSCGAKLKVSCSR
KPAGIDKTYYSADEALVLKQKAEDVVPYLNDRCIYLVGMMGSGKTTVGKILAEVLGYSFF
DSDKLVEKAVGISSVAEIFQLHSEAFFRDNESEVLRDLSSMHRLVVATGGGAVIRPINWS
YMKKGSTIWLDVPLDALARRIAAVGTASRPLLHQESGDPYAKAYAKLTALFEQRMDSYAN
ADARVSLEHIAVKQGHSNVTTLTPSAIAIEALLKMESFLTEKAMIRN
NT seq 864 nt   +upstreamnt  +downstreamnt
atggacgccggtgtgggtctccgggcgaagcccggcgcctgggccggactcggaaaccca
cgccgctcttccacggcgagggttccggtgaggttcgcggtggagaagttcgctcagccg
ttggttttgggctctgatcgccggagctgcggtgccaaactgaaggtttcgtgttccagg
aaaccggcaggtattgacaaaacctattactctgctgatgaagctcttgttctaaagcaa
aaagcagaggacgtggtcccttatttgaatgaccggtgtatttacttagttggaatgatg
ggttctggcaaaactacagttgggaagatattagctgaagtattaggctattctttcttt
gacagcgataagttggttgagaaggcagttggcatatcatctgttgctgaaatctttcag
ctccatagtgaagcattcttcagagataatgagagtgaggtactaagggatttgtcgtca
atgcatcgattagttgttgcaaccggaggtggtgcggtgatccgaccaatcaattggagt
tacatgaagaaagggtcaacaatctggttagatgttccattggatgcacttgcaagacga
attgctgcagtaggaactgcttctcggcccctcttgcatcaagaatctggtgatccttat
gcaaaggcttatgcaaaactgactgcactttttgaacaaagaatggactcatatgctaat
gctgatgccagggtttcactcgaacatattgcagtgaaacaaggacatagtaatgtgacg
acacttacaccaagtgccattgctattgaggcattgctaaagatggagagctttcttact
gagaaggcaatgatcagaaactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340547
Entry
4340547           CDS       T01015                                 
Name
(RefSeq) shikimate kinase 2, chloroplastic isoform X1
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4340547
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     4340547
SSDB
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 CoaE Cytidylate_kin dNK AAA_16 AAA_17 APS_kinase AAA ABC_tran Ploopntkinase3 TsaE AAA_22 AAA_29 tRNA_lig_kinase AAA_5 AAA_28
Other DBs
NCBI-GeneID: 4340547
NCBI-ProteinID: XP_015641676
UniProt: Q5NTH3
LinkDB
Position
6:complement(6494990..6497916)
AA seq 307 aa
MEARAGLAMQSRAAVGVGAGPGVGRRGRAVIRVGKRPTAASLRVGGPAGPAAAKPLAPLY
CLKASRGHDSLHNSVDEALLLKRKSEEVLFYLNGRCIYLVGMMGSGKSTVAKILAEVLGY
SFFDSDKLVEQAVGMPSVAQIFKEHSEAFFRDNESSVLRDLSSMRRLVVATGGGAVIRPV
NWKYMKKGLSVWLDVPLDALARRIAQVGTASRPLLDQPSSDPYTAAFSKLSMLAEQRGDA
YANADARVSLEEIAAKQGHDDVSKLTPTDIAIEALLKIENFVTEHSTSSGPVGDLIVDSQ
NRRTKAL
NT seq 924 nt   +upstreamnt  +downstreamnt
atggaggctagagcggggctggcgatgcagtcgcgggcggctgtcggggtcggagctggc
cccggcgtggggcggcggggccgcgccgtgatccgcgtggggaagcggccaaccgcggcg
agcctgcgggtcggaggccccgccggaccggcggcggccaagcccctcgccccgctgtac
tgcctcaaggcgtccagaggccacgacagcttgcataactcagttgatgaagccctcctg
ttaaagaggaaatcagaagaagttctattctacttgaacggacggtgtatttatttagtt
ggaatgatgggctcagggaagagtacagttgcaaagatattagccgaagttttgggttat
tcattctttgacagtgataagttggttgaacaagcagttggaatgccttctgttgcccaa
atattcaaggagcacagtgaagcgtttttcagagataatgagagtagtgtcttgagggac
ttgtcctcaatgcgacgattagttgttgcaactggaggtggtgccgttattcggccagtt
aactggaaatatatgaagaaaggtctatctgtctggctggatgtgcctttggatgcactt
gcaaggcgtattgctcaagtgggtactgcctctcgtcctcttctggatcagccatcgagt
gatccatacacagcggccttctcaaaactcagcatgcttgcagagcaaagaggcgatgct
tatgcaaatgctgatgctcgagtttctcttgaagaaattgcagctaaacaaggccatgac
gatgtctccaaactaacaccgaccgatattgctattgaggccttactcaagattgagaat
ttcgtcaccgagcattccacatcaagtggcccagttggggacttaatagttgattcccag
aatcgaaggacaaaggccttgtag

DBGET integrated database retrieval system