KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330747
Entry
4330747           CDS       T01015                                 
Name
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4330747
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4330747
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330747
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330747
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     4330747
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4330747
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   4330747
  Exosomal proteins of melanoma cells
   4330747
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-GeneID: 4330747
NCBI-ProteinID: XP_015623414
UniProt: Q0DXI7 Q6Z8J0
LinkDB
Position
2:31597602..31600619
AA seq 332 aa
MAASTSQHALVSVKSLCTGANFGFEKRTSKVRFVLVGRCCSGTRKLGLVCASNSHSSVME
PAQLPLSPESGNTPKKSSESALILIRHGESLWNEKNLFTGCVDVPLTPKGVDEAIEAGKR
ICNIPVDVIYTSSLIRAQMTAMLAMMQHRRKKVPIVVHSESEQAHRWSKIYSEETKKQSI
PVITAWQLNERMYGELQGLNKQETADRFGKEQVHEWRRSYDIPPPNGESLEMCAERAVAY
FKDQIVPQLVAGKHVMIAAHGNSLRSIIMHLDKLTSQEVISLELSTGIPMLYIFKEGKFI
RRGSPAGPSEAGVYAYTRSLAQYRQKLDNMFQ
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctgcttccacgtcccagcatgcgctcgtatccgtcaagtcgttgtgcaccggtgcc
aactttggtttcgaaaagagaaccagcaaagtgcgttttgttttggttgggaggtgctgc
tcgggcacccggaaattgggtttggtatgcgcttcaaactcacattcttcggtgatggag
ccggctcagctaccattgagccccgagagcggaaacaccccaaagaaatcaagtgaaagt
gcgctcatattgatccggcatggtgaatcgctatggaatgagaaaaatctatttactggc
tgcgtcgatgtgcccctgaccccaaagggtgttgacgaggcaattgaggcgggtaaaagg
atatgcaatatcccagttgatgtaatatacacctcgtcactaattcgtgctcagatgacc
gctatgcttgccatgatgcagcatcgtcgtaagaaggttccaattgttgtgcacagtgag
agcgaacaagctcacaggtggagcaagatatacagtgaagagacaaagaagcaatcaatt
cctgtcataacagcttggcagctgaatgaacgaatgtatggggaactacaaggccttaac
aagcaagaaactgctgatcgttttggcaaagaacaagttcatgaatggcgtcgcagttac
gacattcctcccccaaatggcgagagcctagagatgtgtgcagagagagcagttgcttat
tttaaagatcaaattgtacctcagcttgtggcaggaaagcatgtgatgattgctgcccat
ggcaattcacttcgttcaattataatgcacttagacaagttgacttctcaagaggttatc
agccttgaactgtctactggcattcctatgctgtatatatttaaggaaggaaaatttatt
agacgggggagtccggcaggcccttctgaggcaggtgtctatgcctacaccaggagcttg
gctcagtacagacagaagcttgacaacatgtttcagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270925
Entry
9270925           CDS       T01015                                 
Name
(RefSeq) phosphoglycerate mutase-like protein 4
  KO
K15634  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00260  Glycine, serine and threonine metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    9270925
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    9270925
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     9270925
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-GeneID: 9270925
NCBI-ProteinID: XP_015648444
UniProt: B7F8I1
LinkDB
Position
8:complement(23468755..23472636)
AA seq 293 aa
MPTCLPPPPRAAIAAVLTSLLPPPPGASASLAPAGPAAAVARQIRRNDGHHPGAAVGMSS
ASVAERERESEAGEFTEVVVVRHGETAWNASRIIQGHLDVELNEIGRQQAVAVARRLSNE
AKPAAIYSSDLKRAAETAEIIAKACSLPNVVFDPALRERHIGDLQGLKYEDAGKEKPEAY
RAFLSHKRNRQIPGGGESLDQLSERCVSCLYNIVEKHQGERIILVSHGGTIRELYRHASP
MKPLHGKIHNTSVSVILVSGATGRCIVKACGDISHLKETGVLENAFGGDKNSA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgcccacgtgcctgcctcctccgccgcgcgccgccatcgccgccgtcctcacctcgcta
ctaccaccgccaccgggcgcctccgcgtccctcgctcccgccggccccgccgccgccgtc
gcccggcagatccgccggaacgacgggcaccacccgggggcagcggtagggatgtcgtcc
gcgtccgtggcggagagggagagggagagcgaggctggggagttcaccgaggtcgtggtg
gtgcggcacggggagaccgcctggaacgcctcgcgcatcatccaggggcacctggatgta
gaactgaatgagattggaagacaacaagctgttgcggttgcacggcgtctttctaatgaa
gccaagccagctgcgatatattcatctgatctgaagcgagcggcagagactgcagaaata
atagcaaaagcttgcagtttgccaaatgttgtgtttgatccagcactgagagagagacac
atcggagatctgcagggcttaaagtatgaagatgctggcaaagaaaagccagaggcttac
agagcatttttgtcgcacaagaggaaccgacaaattcctggtggtggagaaagtcttgat
caactatcagagcgatgtgtctcttgcttgtacaacatagtcgagaaacatcaaggggag
cgaataatcttggtctcgcacggtggaaccatcagagaactctacaggcatgccagtcca
atgaagcctcttcacggtaagatacacaacacatccgtaagcgtaatccttgtgtctggt
gccactgggcgttgcattgtcaaggcgtgcggggacatcagccaccttaaggaaaccggt
gttctggaaaacgcctttggtggcgataagaactctgcataa

DBGET integrated database retrieval system