KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330767
Entry
4330767           CDS       T01015                                 
Name
(RefSeq) histidine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4330767
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4330767
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4330767
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     4330767
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4330767
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4330767
 Prokaryotic type
    4330767
SSDB
Motif
Pfam: tRNA-synt_His tRNA-synt_2b HGTP_anticodon tRNA-synt_2d DUF4473
Other DBs
NCBI-GeneID: 4330767
NCBI-ProteinID: XP_015625872
UniProt: A3ABH0 Q6Z695
LinkDB
Position
2:complement(31749368..31754468)
AA seq 487 aa
MAASASASLRHHLLLRRRPRFPLGPSPTFRTSSLPRRHQRLFASAPSSSTVENGEPSSPV
EPSDGASVVDVNPPRGTRDFPPEDMRLRTWLFDQFREVSRVMAFEEVDFPVLESEALFIR
KAGEEITQQLYNFEDKGGRRVVLRPEITPSLARLVIKQGKSVSLPLKWFTIGQCWRYERM
TRGRRREHYQWNMDIFGMPKVRAESELLQAIILLFERLGITSSDVGIRVSSRKVLQAVLN
MYSIPEHLFTEVCVIVDKLGKLTREEIEKKLVTIGLSSEAVLGIIEVLSLKSLPKLEEVL
GSDVEAVADLKKLFSFAEQYGYADWICFDASVVRGLAYYTGIVFEAFDRDGKLRAICGGG
RYDRLLSTFGSEDIPACGFGFGDAVIVELLKEKGLLPDLSRQIDDIVFPLDEELEGPACS
VASSLRRQGRSVDLVEDKRLKWVFKHAERINAGRLILVGKSEWERGMVRVKILSTREEFE
VKAGELQ
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggccgcctccgcgtcggcgtcgctgcgccaccacctcctcctccgccgccgcccgcgc
ttccccctcggccctagccccactttccgcacctcctccctaccccgccgccaccagcgg
ctcttcgcctctgccccatcctcgtcgacggtggagaatggcgagccctcctcgccggtg
gagccgtccgacggtgcgtccgtcgtcgacgtgaatccgccgcgcgggaccagggatttc
cccccggaggacatgcgcctccgcacctggctcttcgaccagttcagggaggtgtcccgc
gtcatggcgtttgaggaggtggacttcccagtgctcgagtctgaggcgctcttcattcgc
aaggccggagaggagatcacgcagcagctttataacttcgaggataaaggagggcgccgt
gttgttctgaggcctgaaatcaccccttccttggcacgcctagttataaagcaaggaaaa
tcagtctcccttccactgaaatggtttactataggacaatgctggcgatatgagcgtatg
acaagaggaagacggcgtgaacattatcaatggaacatggatatttttggcatgcctaaa
gttcgagcagagtctgagcttcttcaagctattattctcttatttgaacgtcttgggatt
acatcttcagatgtggggatcagagtgtccagccgaaaggtccttcaggctgtgttgaat
atgtactccattccagaacatttgtttactgaagtttgtgtgattgttgataaactggga
aagctgactagagaagaaattgagaagaagttggttacaattgggctgtcatctgaagct
gtgctgggtatcattgaggttctttctctcaagtcgctacccaagcttgaagaggtgcta
ggctctgatgttgaagctgttgctgacttgaagaagttgttctcgtttgctgagcagtac
ggttatgctgattggatttgttttgatgcatctgttgttcgtggccttgcatactacaca
ggaattgtttttgaggcttttgatagagatggaaaactgagagcaatttgtggtggagga
aggtatgatagactactttcaacatttggtagtgaagacataccagcttgcggctttgga
tttggagacgctgttatagtggaactgctgaaagaaaagggtctgttacctgatctgtca
cgccaaatagatgacattgtcttcccattggatgaggagcttgaagggccagcatgtagt
gttgcttcctctctgcggaggcaaggcagaagtgtagaccttgttgaagacaagcgtctt
aaatgggtatttaagcatgctgagaggataaatgctggtaggctgatattggtcggaaaa
tccgagtgggagcgaggtatggttcgtgtgaagatattatcaaccagagaagaatttgag
gtcaaggctggcgaactacaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337830
Entry
4337830           CDS       T01015                                 
Name
(RefSeq) histidine--tRNA ligase, cytoplasmic
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4337830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4337830
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4337830
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     4337830
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4337830
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4337830
 Prokaryotic type
    4337830
SSDB
Motif
Pfam: tRNA-synt_His HGTP_anticodon HGTP_anticodon2 Lyase_aromatic tRNA-synt_2b tRNA-synt_2 tRNA-synt_2d
Other DBs
NCBI-GeneID: 4337830
NCBI-ProteinID: XP_015639741
UniProt: A0A0P0WI14
LinkDB
Position
5:complement(2928151..2931984)
AA seq 885 aa
MAPPAAAAAVTLGGKGAALTPAAVYALSHGLADPAIDPSALQRLSTRGPSPQDTPASLRG
LALSPPESRAAAAVLLNKLLVTAGDSSALVTAATATGLAGSLDLAAALPPASRDEAAVAA
ASAPVAVALAAAIDCCASPLVRVADAVAALSCEAARGDVAAFDVPTSGDGLSAKDEADVA
ADVKMLLFGSKLVGAAGGADAASFTKVPTVNGIFREAVRALHARVRIELNAPVKLGKRDA
VQTGEGKEEALVALATQLARPVQAMLKLSVARARLCVARIDDAELRKKLTDGVEIDDLKG
MLGKVTIDSDAVSVLRGVYNSLLKFRDILAWEAAVAMAVIEMDSSIEKPQACEENEAGSS
TENPHASGEKPKGDKKSKKKKTLGKGTSAVLMLLRDLVTNGKEVLSVNSALLAEWGTELS
LLFDPKCPRLVSLVDKVKEIVETNEVRRLPKIPKGTRDFGKEQMAIREHAFSIITGVFKM
HGAVSLDTPVFELRETLMGKYGEDSKLIYDLADQGGELCSLRYDLTVPFARYVAMNNISS
LKRYQIAKVYRRDNPSKGRYREFYQCDFDIAGVYETMEPDFEVIKVLTELLDQLDIGTYE
IKLNHRKLLDGMLEICGVPPEKFRTVCSSIDKLDKQTFEQVKKELVDEKGISNETADKIG
DLVKTRGPPLEVLLELRKEGSKFMGNAGSVTALNELEILFKALDKANAIGKIVFDLSLAR
GLDYYTGVIYEAVFKGTTQVGSIAAGGRYDNLVGMFSGKQVPAVGVSLGIERVFAIMEQQ
EMEKNQIRATETEVLVSIIGKDLILAAELVSELWNAGIKAEFKLTTRIQNHLKYATQSGI
PWMVLVGESEISSGKVKLKNLAASQEEEVDRTEFAQVLKQKLRNP
NT seq 2658 nt   +upstreamnt  +downstreamnt
atggcgcctcccgccgccgccgccgccgtgacgctcggtggcaagggcgccgcgctcacc
cccgccgccgtctacgccctctcccacggcctcgccgaccccgccatcgacccatccgcg
ctccagaggctctccacgcgcggcccctcgccgcaggacacccccgcgtcgctccgcggc
ctcgccttgtcgccgccggagtcacgcgccgccgcggcggtgctgctcaacaagctcctg
gtcaccgcgggggactcctctgccctcgtgaccgccgcgacggccaccggcctcgctggg
tcgctcgacctcgccgccgcgctgcccccggcctcccgcgacgaggccgcagtcgctgcc
gcctccgcgcccgtggccgtcgcgctcgccgccgcgatcgactgctgcgcgtccccgctc
gtccgcgtcgccgacgccgtcgccgcgctctcctgcgaggccgcgcgcggggacgtcgcg
gcctttgatgtgccgacctctggtgatggtctctccgccaaggacgaggctgatgtcgcc
gccgatgtcaagatgctcctcttcgggtccaagctcgtcggcgcagccggtggcgccgat
gccgcgtctttcactaaggtgcccaccgtgaatggaatcttccgcgaggcagtgcgcgcg
ctgcacgcgagggtgcgtatcgagctcaacgctccagtgaagttgggaaagagggacgct
gtccaaaccggtgagggaaaggaggaggcattggttgctctggcaacgcaactcgcgagg
ccggtacaggcaatgctcaagcttagcgttgcgcgggcaaggctttgtgttgcgagaatt
gatgatgctgagctccggaagaagcttactgatggtgttgaaatcgatgatttgaagggg
atgcttggcaaggtcacgattgattcggatgctgtatctgttttgcggggtgtgtacaac
tccctgctcaagttcagggatatccttgcatgggaagcagctgttgccatggcggtgatc
gaaatggatagttcaattgagaagccacaagcttgtgaggagaatgaggcgggcagttca
actgaaaatccgcatgctagtggagagaaaccaaaaggtgacaagaagagcaagaagaag
aaaactttggggaagggtacttctgctgtactgatgttgcttagggaccttgtgaccaac
ggaaaggaggttctttcggtgaattctgcactacttgcagagtggggaaccgagctctca
ctgttgtttgatccaaagtgtcccagattggtgtcccttgtggacaaggtgaaggagatt
gttgagaccaatgaagtgaggagattgcctaaaattcccaagggaacacgtgactttggg
aaagagcaaatggccataagggagcatgccttctcaataataacaggtgtattcaagatg
cacggtgccgtttcacttgatacacctgtatttgagctgagagaaacacttatgggcaaa
tatggtgaagactcaaagttgatttatgaccttgctgatcagggtggagagctttgctct
ttgcggtatgatctgactgttccatttgcccgatatgttgctatgaataacataagttca
ttgaagagataccagatagctaaagtatacaggagagataacccgtccaagggaagatat
cgagaattctaccaatgcgactttgacatagctggagtatatgaaacaatggaaccagat
tttgaagttatcaaagttttaactgagttgttggatcagttggatataggcacgtatgag
ataaaactaaaccacagaaagttgcttgatggaatgttagagatctgtggtgtgcctcct
gaaaagttcagaacggtttgctcaagcattgacaagctagacaagcaaacatttgaacaa
gtgaaaaaggaactggtggacgagaagggcatatctaatgaaactgcggataagattggt
gatttagtgaaaactaggggaccaccgctggaagttttgctggaattgagaaaggaaggt
agcaagtttatggggaacgctgggtctgttactgcactaaatgagctggagatactattc
aaagctctagataaagcaaatgcaataggcaagattgtttttgatttaagccttgctaga
ggccttgattactacactggtgtgatatatgaagctgtgttcaagggcaccactcaggtt
ggctccattgctgctggaggcaggtatgacaaccttgttggtatgtttagtgggaagcaa
gtccctgccgttggtgttagccttggaatagaaagagttttcgcaatcatggagcaacag
gagatggaaaagaatcagatccgggccaccgagacggaggtattggtgtcgattatcggc
aaggacctcatattggccgctgagcttgttagtgaactgtggaatgctgggataaaggca
gagttcaaactcactactaggatacagaaccacttgaagtacgcgacgcaatctggcatt
ccgtggatggtgctggttggtgagtctgaaataagcagtggaaaggtgaagctgaagaac
ttggcagccagccaggaagaggaggttgacaggacagagtttgctcaggtgttgaaacag
aaattgagaaacccatag

DBGET integrated database retrieval system