KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330828
Entry
4330828           CDS       T01015                                 
Name
(RefSeq) chlorophyll a-b binding protein 4, chloroplastic
  KO
K08911  light-harvesting complex I chlorophyll a/b binding protein 5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00196  Photosynthesis - antenna proteins
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    4330828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    4330828
Photosynthesis proteins [BR:osa00194]
 Antenna proteins
  Light-harvesting chlorophyll-protein complex (LHC) - Plant, Green alga [OT]
   LHCI
    4330828
SSDB
Motif
Pfam: Chloroa_b-bind
Other DBs
NCBI-GeneID: 4330828
NCBI-ProteinID: XP_015623305
UniProt: B9F350 Q6Z7Q1
LinkDB
Position
2:complement(32199540..32201717)
AA seq 261 aa
MASLGANSHGRVLHTCTLSPKPVTALSRSMAAIPGHHVFQSPRARIAVRASTERATWLPG
LDPPPHLDGTLPGDFGFDPLGLGEEPANLKWYVQAELVHCRFAMAGVAGILATDLIRVSG
INNLPVWFEAGATKFDFANTTALFFVQLLLMGFAETKRYMDFINPGSQAEEGTFLGIEAA
LAGSQPGYPGGPLFNPLGLAKDIENADEAKLKEIKNGRLAMVAMLGFIVQASVTHVGPID
NLLTHLSDPFNKNIIHTLSSS
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcgtcgttaggagctaacagccatggccgagtcctgcacacctgcacactctcccca
aagccggttacagctttgagcagaagcatggcggccattcctggacaccatgtttttcag
tctccacgagctcggattgcagtgcgagctagcaccgagcgtgcgacctggctgcctggg
ctcgatccacctcctcacctcgacggcacattacctggcgatttcggatttgatcccctg
ggtctcggggaggaaccggcaaacttgaaatggtatgttcaagccgaacttgtgcactgc
cggtttgcgatggcaggggttgctggcatccttgcgactgatttgatacgtgtatcagga
atcaacaacctgccagtgtggtttgaagcaggtgcaacaaaattcgacttcgctaacacc
acggcactcttctttgtccagcttctcttgatgggatttgctgaaaccaagaggtacatg
gactttatcaatccaggatcacaagcagaggaaggaacattccttggtatcgaggctgca
cttgcaggttcacagccaggctaccctgggggtccactgtttaatccactaggactggcc
aaggatatagagaatgcagatgaagcgaaactgaaagaaatcaagaatgggaggttggct
atggttgctatgcttgggtttattgtgcaagcatctgtgactcatgttggaccaatcgac
aatcttttgacacatctttcagacccgttcaacaaaaatatcatccacaccctctcctct
tcttga

DBGET integrated database retrieval system