KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330843
Entry
4330843           CDS       T01015                                 
Name
(RefSeq) flavonol synthase/flavanone 3-hydroxylase
  KO
K05278  flavonol synthase [EC:1.14.20.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00941  Flavonoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4330843
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.6  flavonol synthase
     4330843
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4330843
NCBI-ProteinID: XP_015624815
UniProt: Q0DX94 Q6Z306
LinkDB
Position
2:complement(32310715..32312423)
AA seq 331 aa
MAEVQSVQALASSLAALPPEFVRSEHERPGATTFRGGDAPEIPVIDMAAPESAARVAEAA
AEWGLFQVVNHGVPAAAVAELQRVGREFFALPQEEKARYAMDASSGKMEGYGSKLQKDLE
GKKAWADFFFHNVAPPAMVNHDIWPSHPAGYREANEEYCKHMQRLARKLFEHLSTALGLD
GGAMWEAFGGDELVFLHKINFYPPCPEPELTLGVAPHTDMSTFTVLVPNDVQGLQVFKDG
HWYDVKYVPDALIIHIGDQIEILSNGRYKAVLHRTTVDKDRTRMSWPVFVEPPPEHVVGP
HPQLVTDGSPAKYKAKKFKDYRHCKINKLPM
NT seq 996 nt   +upstreamnt  +downstreamnt
atggcggaggtgcagagcgtgcaggcgctggcgtcgtcgctggcggcgctgccgccggag
ttcgtgcgttccgagcacgagcggccgggggcgaccacgttccgcggcggcgacgcgccg
gagatcccggtgatcgacatggcggcgcccgagtccgccgcgcgcgtggcggaggcggcg
gcggagtgggggctcttccaggtggtgaaccacggcgtgcccgccgcggcggtggcggag
ctgcagcgcgttgggcgcgagttcttcgcgctgccgcaggaggagaaggcgcggtacgcc
atggacgcgtcctccggcaagatggagggctacggcagcaagctgcagaaggacctcgag
ggcaagaaggcgtgggccgacttcttcttccacaacgtcgcgccgccggccatggtcaac
cacgacatctggcccagccatccggctggctacagggaggcgaacgaggagtactgcaag
cacatgcagcggctggcgcggaagctgttcgagcacctgtcgacggcgctgggactggat
ggcggcgccatgtgggaggcgttcggcggcgacgagctggtgttcctgcataagatcaac
ttctacccgccgtgcccggagccggagctaaccctcggcgtcgcgccgcacaccgacatg
agcacgttcaccgtcctcgtccccaacgacgtccagggcctccaggtattcaaggatggc
cactggtacgacgtcaagtacgtccccgacgccctcatcatccacatcggcgaccagatc
gagattctgagcaacgggaggtacaaggcggtgctgcatcggacgacggtggacaaggac
aggacgcggatgtcgtggccggtgttcgtcgagccgccgccggagcacgtcgtcgggccg
cacccgcagctcgtcaccgacgggagcccggccaagtacaaggccaagaagttcaaagat
taccggcactgcaagatcaataagctccccatgtaa

DBGET integrated database retrieval system