KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330867
Entry
4330867           CDS       T01015                                 
Name
(RefSeq) nitrate reductase [NAD(P)H]
  KO
K10534  nitrate reductase (NAD(P)H) [EC:1.7.1.1 1.7.1.2 1.7.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Module
osa_M00531  Assimilatory nitrate reduction, nitrate => ammonia
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4330867
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.1  nitrate reductase (NADH)
     4330867
    1.7.1.2  nitrate reductase [NAD(P)H]
     4330867
    1.7.1.3  nitrate reductase (NADPH)
     4330867
SSDB
Motif
Pfam: Oxidored_molyb Mo-co_dimer FAD_binding_6 NAD_binding_1 Cyt-b5 NAD_binding_6
Other DBs
NCBI-GeneID: 4330867
NCBI-ProteinID: XP_015622710
UniProt: A0A0P0VPX4 Q6ZHH7
LinkDB
Position
2:complement(32513739..32517167)
AA seq 889 aa
MAASVEYKLAPHPWASNAPSSNLDLFPSGGGKRRSGSETDSDDEDSIPPDWRSLYHPRLE
VAEPAVKDPRDEATSDAWVRRHPALVRLTGKHPFNSEPPLPRLMSHGFITPAPLHYVRNH
GAVPKADWSTWAVEVTGLVKRPARLNMEQLVTGFEAVELPVTLVCAGNRRKEQNMVRQTV
GFNWGPGAISTSVWRGVRLRDVLRWCGVMGASAGAANVCFEGAEDLPGGGGCKYGTSLRR
EVAMDPAHDVILAYMQNGEPLTPDHGFPVRVIVPGFIGGRMVKWLKRIIVASSESESYYH
YRDNRVLPSHVDAELANAEAWWYKPEYMINELNINSVITTPGHDEVLPINALTTQRPYTM
KGYAYSGGGRKVTRVEVTLDGGETWQVCNLDHPERPTKYGKYWCWCFWSVDVEVLELLAA
KEIAVRAWDESLNTQPEKLIWNLMGMMNNCWFRVKTKTCRPHKGEIGLVFEHPTQPGNQA
GGWMARQKHLETSESAVSTLKRSTSTPFLNTATTQYTMSEVRRHTTPESAWIIVHGHVYD
CTGFLKDHPGGADSIMINAGTDCTEEFDAIHSDKARGLLEMYRIGELIVTGSDYSPQSSS
ADLTSIVESPTAAAAPAVPVSTVALSNPREKVKCRLMDKKSLSYNVRLFRFALPSPDQKL
GLPVGKHVYVCASIGGKLCMRAYTPTSSVDEVGYIELLIKIYFKGEDPKFPDGGLMSQYL
DYLPLGATIDIKGPIGHIEYAGRGAFTVNGERRFARRLAMVAGGTGITPVYQVIQAVLWD
QPDDGTEMHVVYANRTEDDMLLREEIDRWAAAHPARLKVWYVVSKVARPEDGWEYGVGRV
DERTLREHLPPGDGETLALVCGPPAMVECTVRPGLEKMGYDLDKSCLVF
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggcggcctcggtggagtacaagctggctccgcacccgtgggcgagcaatgctccgtcg
agcaacctcgacttgttcccgtccggcggcggcaagcgccgttcgggctccgagaccgac
tccgacgacgaggacagcataccaccggactggaggtcgctgtaccacccgcggctggag
gtggcggagccggccgtcaaggacccccgcgacgaggccacctccgacgcgtgggtgcgt
cgccacccggcgctcgtccggctcaccggcaagcacccgttcaactccgagccgccgctg
ccgcgcctcatgtcgcacggcttcatcacgccggcgccgctccactacgtgcgcaaccac
ggcgccgtgcccaaggcggactggtcgacgtgggccgtggaggtgaccgggctcgtcaag
cgccccgcgaggctcaacatggagcagctcgtgaccgggttcgaggccgtggagctcccc
gtcacgctggtgtgcgcgggcaaccggcgcaaggagcagaacatggtgcgccagaccgtg
ggcttcaactggggccccggcgccatctccacctccgtgtggcgcggcgtgcggctgcgc
gacgtgctgcggtggtgcggtgtcatgggcgcctccgccggcgcggccaacgtgtgcttc
gagggcgccgaggacctcccaggcggcggcgggtgcaagtacggcaccagcctgcgccgc
gaggtggccatggaccccgcccacgacgtcatcctcgcctacatgcagaacggcgagccg
ctcacgcccgaccacggcttccccgtccgggtcatcgtcccgggcttcatcggcggccgc
atggtgaaatggctcaagcgcatcatcgtcgcgtccagcgagtcggagagctactaccat
taccgcgacaaccgcgtcctcccgtctcacgtcgacgccgagctcgccaatgccgaagct
tggtggtacaagccggagtacatgataaacgagctgaacataaactcggtgatcaccacg
ccgggacacgatgaggtgctccccatcaatgcgctgacgacgcagcggccgtatacgatg
aagggatacgcctactccggcggtggccggaaagttacaagggtagaggtgaccctggac
ggcggcgagacgtggcaggtgtgcaaccttgaccacccggagaggccgaccaagtacgga
aagtactggtgctggtgcttctggtccgtcgatgtcgaggtgctcgagctgctcgccgcc
aaggagatcgccgtccgcgcctgggacgagtccctcaacacccagccggagaagctcatt
tggaatctcatgggcatgatgaacaactgctggttcagggtgaagacgaagacgtgcagg
ccgcacaagggggagatcgggctggtgttcgagcacccgacgcagccgggcaaccaggcc
ggcgggtggatggcgaggcagaagcacctcgagacgtcggagagcgcggtgagcacgctg
aagcgcagcacgtccacgccgttcctcaacacggccaccacgcagtacaccatgtccgag
gtgcgccgccacacgacgccggagtccgcctggatcatcgtgcacggccatgtctacgac
tgcacggggttcctcaaggaccaccccggcggcgccgacagcatcatgatcaacgccggc
accgactgcaccgaggaattcgacgccatccactccgacaaggcccgtggcctcctcgag
atgtaccgcatcggcgagctcatcgtcaccggcagcgactactcgccgcagagcagcagt
gctgacctcacgtccatcgttgagagccctacggcagcggcggcgcccgccgtgccggtg
tcgaccgtcgcgctgtccaacccgcgggagaaggtgaaatgccggctcatggacaagaag
agcctgtcctacaacgtgcgcctgttccggttcgcgctgccgtcgccggaccagaagctc
gggctaccggtcggcaagcacgtgtacgtgtgcgcgtcgatcggcggcaagctctgcatg
cgcgcgtacacgccgacgagctccgtcgacgaggtcggctacatcgagctcctgatcaag
atatacttcaagggcgaggaccccaagttccccgacggcgggctcatgtcgcagtacctg
gactacctgccgctcggcgccaccatcgacatcaagggcccgatcgggcacatcgagtac
gccggccgcggcgccttcacggtgaacggcgagcgccggttcgcgcggcggctcgccatg
gtggccggcgggacggggatcacgccggtgtaccaggtgatccaggccgtgctctgggac
cagcccgacgacggaacggagatgcacgtggtgtacgcgaaccggacggaggacgacatg
ctcctccgggaggagatcgaccggtgggcggcggcgcacccggcgcggctcaaggtgtgg
tacgtggtgagcaaggtggcgcggccggaggacgggtgggagtacggcgtggggagggtg
gacgagcggacgctcagggagcacctgccgccgggcgacggcgagacgctcgcgctcgtg
tgcgggccgccggcgatggtcgagtgcacggtgcggccgggcctggagaagatgggctat
gacctcgacaagtcctgcctcgtcttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345795
Entry
4345795           CDS       T01015                                 
Name
(RefSeq) nitrate reductase [NADH] 1
  KO
K10534  nitrate reductase (NAD(P)H) [EC:1.7.1.1 1.7.1.2 1.7.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Module
osa_M00531  Assimilatory nitrate reduction, nitrate => ammonia
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4345795
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.1  nitrate reductase (NADH)
     4345795
    1.7.1.2  nitrate reductase [NAD(P)H]
     4345795
    1.7.1.3  nitrate reductase (NADPH)
     4345795
SSDB
Motif
Pfam: Oxidored_molyb Mo-co_dimer NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6
Other DBs
NCBI-GeneID: 4345795
NCBI-ProteinID: XP_015650300
UniProt: P16081
LinkDB
Position
8:23033215..23038595
AA seq 916 aa
MAASVQPRQFGHLEPGSAPVRGAASSNGAKAYPPANGIPRRADSPVRGCGFPPLVSPPPR
KPPSDGSDDEEEEQEDWRELYGSHLQLEVEPPVRDARDEGTADAWIERNPSLIRLTGKHP
LNCEPPLARLMHHGFITPAALHYVRNHGAVPRGDWSTWTVDVTGLVKRPMRLTMDELVNG
FPAVEIPVTLVCAGNRRKEQNMVQQTVGFNWGAAGVSTSVWRGARLRDVLRRCGIMPSKG
GALNVCFEGAEDLPGGGGSKYGTSITRQWALDPSRDIMLAYMQNGEPLLPDHGFPVRAII
PGCIGGRMVKWVKRIIVTTAESDNYYHYKDNRVLPSHVDAELANADAWWYKPEYIINELN
VNSVITTPGHDEILPINGITTQRGYTMKGYAYSGGGKRITRVEVTLDGGETWLVCVLDLP
EKPTKYGKHWCWCFWSVEVEVLDLLGAKEIAVRAWDQSHNTQPEKLIWNLMGMMNNCWFK
VKVNVCRPHKGEIGLVFEHPTQPGNQTGGWMARQKHLETAEAAAPGLKRSTSTPFMNTTD
GKQFTMSEVRKHSSQDSAWIVVHGHVYDCTAFLKDHPGGADSILINAGTDCTEEFDAIHS
DKAKALLDTYRIGELITTGAGYSSDNSVHGASNLSQLAPIREAIKAPAPVALSSPRDKVP
CQLVDKKELSRDVRLFRFALPSSDQVLGLPVGKHIFVCASIEGKLCMRAYTPTSMVDEVG
HFDLLIKVYFKNEHPKFPDGGLMTQYLDSLPVGAYIDVKGPLGHVEYTGRGEFVINGKPR
NARRLAMIAGGSGITPMYQVIQSVLRDQPEDTTEMHLVYANRTEDDILLRDELDRWAAEY
PDRLKVWYVIDQVKRPEEGWKYGVGFVTEEVLREHVPEGGDDTLALACGPPPMIKFAVSP
NLEKMKYDMANSFIVF
NT seq 2751 nt   +upstreamnt  +downstreamnt
atggctgcttccgtgcagccgcggcagttcggccacctcgagccgggctccgcgccggtg
cgcggcgccgcctcctcgaacggcgccaaggcgtaccctcccgcgaacggcatcccacgc
cgcgccgactcgccggtgcgcgggtgcggcttccctccgctcgtctcgccaccgccgcgg
aagccgcccagcgacgggtcggacgacgaggaggaggagcaggaggactggcgggagctg
tacggctcgcacctgcagctggaggtggagccgccggtgcgcgacgcgcgcgacgagggc
accgccgacgcgtggatcgagcgcaacccgtcgctgatccggctcaccgggaagcacccg
ctgaactgcgagccgccgctggcgaggctcatgcaccacggcttcatcaccccggcggcg
ctgcactacgtgcgcaaccacggcgccgtgccgcggggtgactggtcgacgtggaccgtc
gatgtgacggggctcgtcaagcggcccatgcggctcaccatggacgagctggtcaacggc
ttccccgccgtcgagatccccgtcacgctggtctgcgcgggcaaccgccgcaaggagcag
aacatggtgcagcagacggtggggttcaactggggcgccgctggcgtgtctacgtcggtg
tggcgcggcgcccgcctccgcgacgtgctccggcggtgcggcatcatgcccagcaagggc
ggcgcgctcaacgtgtgcttcgagggcgccgaggacctccccggcggcggcggctccaag
tacggcaccagcatcacacgccagtgggcgctggacccgtcgcgggacatcatgctcgcc
tacatgcagaatggcgagccgctgctccccgaccacggcttccccgtccgcgccatcatc
cccggctgcatcggcggccgcatggtcaagtgggtcaagcgcatcatcgtcaccaccgcc
gagtccgacaactactaccattacaaggacaaccgcgtcctcccgtcccatgtcgacgcc
gagctcgccaacgccgatgcgtggtggtacaagccagagtacatcatcaacgagctgaac
gtgaactcggtgatcacgacgcccgggcacgacgagatcctgcccatcaacggcatcacc
acgcagcgcggctacaccatgaagggatacgcctactccggcggcggcaagaggatcacg
cgggtggaggtgacgctggacggcggcgagacatggctggtgtgcgtgctggacctcccg
gagaagcccaccaagtacggcaagcactggtgctggtgcttctggtccgtcgaggtcgag
gtgctcgacctcctcggcgccaaggagatcgccgtgcgcgcctgggaccagtcgcacaac
acccagcccgagaagctcatctggaatctcatggggatgatgaacaactgctggttcaag
gtgaaggtgaacgtgtgccggccgcacaagggtgagatcgggctggtgttcgagcacccg
acgcagcccgggaaccagaccggcgggtggatggcgaggcagaagcacctggagacggcg
gaggcggccgcaccggggctgaagcggagcacgtcgacgccgttcatgaacaccaccgac
ggcaagcagtttaccatgtccgaggtgcgcaagcactcgtcgcaggactcggcgtggatc
gtcgtccacggtcacgtctacgactgcacggccttcctcaaggaccaccccggcggcgcc
gacagcatcctcatcaacgccggcaccgactgcaccgaggagttcgacgccatccactcc
gacaaggccaaggcgctcctcgacacctaccgcatcggcgagctcatcaccaccggcgcc
gggtacagctccgacaactccgtccacggcgcgtccaacctctcccagctcgcccccatc
cgcgaggccatcaaggcgccggcgcccgtcgcgctctccagcccgcgcgacaaggtcccc
tgccaactcgtcgacaagaaggagctctcccgcgacgtccgcctcttccgcttcgcgctg
ccgtcctccgaccaggtgctcggcctccccgtcggcaagcacatcttcgtgtgcgccagc
atcgaagggaagctgtgcatgcgggcgtacacgccgacgagcatggtcgacgaggtcggc
cacttcgacctcctcatcaaggtgtacttcaagaacgagcaccccaagttccccgatggc
gggctcatgacgcagtacctggactcgctccccgtgggcgcctacatcgacgtcaagggg
ccactcggccacgtcgagtacaccggccgcggcgagttcgtcatcaacggcaagccgcgg
aacgcgcggcggctggcgatgatcgccggcgggagcgggatcacgcccatgtaccaggtc
atccagtcggtgctgcgcgaccagccggaggacacgacggagatgcacctggtgtacgcg
aaccggacggaggacgacatcctcctccgcgacgagctcgaccggtgggcggcggagtac
ccggacaggctcaaggtgtggtacgtcatcgaccaggtgaagcggccggaggaagggtgg
aagtacggcgtcgggttcgtcacggaggaggtgctgcgggagcacgtgccggagggcggc
gacgacacgctcgcgctcgcctgcgggccgccgccgatgatcaagttcgccgtctcgccg
aacctggagaagatgaagtacgacatggccaattctttcatcgtgttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345798
Entry
4345798           CDS       T01015                                 
Name
(RefSeq) nitrate reductase [NADH] 1-like
  KO
K10534  nitrate reductase (NAD(P)H) [EC:1.7.1.1 1.7.1.2 1.7.1.3]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Module
osa_M00531  Assimilatory nitrate reduction, nitrate => ammonia
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4345798
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.1  nitrate reductase (NADH)
     4345798
    1.7.1.2  nitrate reductase [NAD(P)H]
     4345798
    1.7.1.3  nitrate reductase (NADPH)
     4345798
SSDB
Motif
Pfam: Oxidored_molyb Mo-co_dimer NAD_binding_1 FAD_binding_6 Cyt-b5 NAD_binding_6
Other DBs
NCBI-GeneID: 4345798
NCBI-ProteinID: XP_015650643
UniProt: A0A0P0XGV5 Q6ZC33
LinkDB
Position
8:complement(23051487..23055680)
AA seq 916 aa
MAASVQPRQFGHLEPGSAPVCGAASSNGAKAYPPANGIPRRADSPVRGCGFPPLVSPPSR
KPPSDGSDDEEEEQEDWRELYGSHLQLEVEPSVRDARDEGTADAWIERNPLLIRLTGKHP
LNCEAPLARLMHHGFITPAALHFVRNHGAVPRGDWSTWTVEVTGLVKRPMRLTVDELVNG
FPAVEVPVTLACSGNRRKEQNMVQQTVGFNFGAAAVSTSVWHGARLRDVLRRCGIMPSKG
GALNVCFEGAEDLPGGGGSKYGTSITRQWALDPSRDIMLAYMQNGEPLLPDHGFPVRAII
PGCTGGRMVKWVKRIIVTTAESDNYYHYKDNRVFPSHVDAELANADAWWYKPEYIINELN
VNSVITAPGHDEILPINGITTQRGYTMKGYAYSGGGKRITRVEVTLDGGETWLVCVLDLP
EKPTKYGKHWCWCFWSVEVEVLDLLGAKEIAVRAWDQSHNTQPEKLIWNLMGMMNNCWFK
VKVNVCRPHKGEIGLVFEHPTQPGNQTGGWMARQKHLETAEAAAPGLKRSTSTPFMNTTD
GKQFTMSEVRKHSSQDSAWIVVHGHVYDCTAFLKDHPGGADSILINAGTDCTEEFDAIHS
DKAKALLDTYRIGELITTGAGYSSDNSVHGASNLSQLAPIREAIKAPAPVALSSPRDKVP
CQLVDKKELSRDVRLFRFALPSSDQVLGLPVGKHIFVCASIEGKLCMRAYTPTSMVDEVG
HFDLLIKVYFKNEHPKFPDGGLMTQYLDSLPVGAYIDVKGPLGHVEYTGRGEFVINGKPR
NARRLAMIAGGSGITPMYQVIQSVLRDQPEDTTEMHLVYANRTEDDILLRDELDRWAAEY
PDRLKVWYVIDQVKRPEEGWKYGVGFVTEEVLREHVPEGGDDTLALACGPPPMIKFAVSP
NLEKMKYDMANSFIVF
NT seq 2751 nt   +upstreamnt  +downstreamnt
atggccgcttccgtgcagccgcggcagttcggccacctcgagccgggctccgcgccggtg
tgcggcgccgcatcctcgaacggcgccaaggcgtaccctcccgcgaacggcatcccgcgc
cgcgccgactcaccggtgcgcgggtgcggcttccctcccctcgtctcgccaccttcgcgg
aagccgcccagcgatgggtcggacgacgaggaggaggagcaggaggactggcgggagctg
tacggctcgcacctgcagctggaggtggaaccgtcggtgcgcgacgcgcgcgacgagggc
accgccgacgcgtggatcgagcgcaacccgttgctgatccggctcaccgggaaacacccg
ctgaactgcgaggcgccgctggcgaggctcatgcaccacggcttcatcaccccggctgcg
ctgcacttcgtgcgcaaccacggcgcagtgccgcggggtgactggtcgacgtggaccgtc
gaggtgacggggctcgtcaagcgtcccatgcggctcaccgtggacgagctggtcaacggc
ttccccgccgtggaggtccccgtcacgctggcctgctcggggaaccgccgcaaggagcag
aacatggtgcagcagactgtggggttcaactttggcgccgccgccgtgtccacgtcggtg
tggcacggcgcccgcctccgcgacgtgctccggcggtgcggcatcatgcccagcaagggc
ggtgcgctcaacgtgtgcttcgagggcgccgaggacctccccggcggcggcggctccaag
tacggcaccagcatcacacgccagtgggcgctggacccgtcgcgggacatcatgctcgcc
tacatgcagaatggcgagccgctgctccccgaccacggcttccccgtccgcgccatcatc
cccggctgcaccggcggccgcatggtcaagtgggtcaagcgcatcatcgtcaccaccgcc
gagtccgacaactactaccattacaaggacaaccgcgtcttcccgtcccatgtcgacgcc
gagctcgccaacgccgatgcgtggtggtacaagccggagtacatcatcaacgagctgaac
gtgaactcggtgatcacggcgcccgggcacgacgagatcctgcccatcaacggcatcacc
acgcagcgcggctacaccatgaagggatacgcctactccggcggcggcaagaggatcacg
cgggtggaggtgacgctggacggcggcgagacatggctggtgtgcgtgctggacctcccg
gagaagcccaccaagtacggcaagcactggtgctggtgcttctggtccgtcgaggtcgag
gtgctcgacctcctcggcgccaaggagatcgccgtgcgcgcctgggaccagtcgcacaac
acccagcccgagaagctcatctggaatctcatggggatgatgaacaactgctggttcaag
gtgaaggtgaacgtgtgccggccgcacaagggtgagatcgggctggtgttcgagcacccg
acgcagcccgggaaccagaccggcgggtggatggcgaggcagaagcacctggagacggcg
gaggcggccgcaccggggctgaagcggagcacgtcgacgccgttcatgaacaccaccgac
ggcaagcagtttaccatgtccgaggtgcgcaagcactcgtcgcaggactcggcgtggatc
gtcgtccacggtcacgtctacgactgcacggccttcctcaaggaccaccccggcggcgcc
gacagcatcctcatcaacgccggcaccgactgcaccgaggagttcgacgccatccactcc
gacaaggccaaggcgctcctcgacacctaccgcatcggcgagctcatcaccaccggcgcc
gggtacagctccgacaactccgtccacggcgcgtccaacctctcccagctcgcccccatc
cgcgaggccatcaaggcgccggcgcccgtcgcgctctccagcccgcgcgacaaggtcccc
tgccaactcgtcgacaagaaggagctctcccgcgacgtccgcctcttccgcttcgcgctg
ccgtcctccgaccaggtgctcggcctccccgtcggcaagcacatcttcgtgtgcgccagc
atcgaagggaagctgtgcatgcgggcgtacacgccgacgagcatggtcgacgaggtcggc
cacttcgacctcctcatcaaggtgtacttcaagaacgagcaccccaagttccccgatggc
gggctcatgacgcagtacctggactcgctccccgtgggcgcctacatcgacgtcaagggg
ccactcggccacgtcgagtacaccggccgcggcgagttcgtcatcaacggcaagccgcgg
aacgcgcggcggctggcgatgatcgccggcgggagcgggatcacgcccatgtaccaggtc
atccagtcggtgctgcgcgaccagccggaggacacgacggagatgcacctggtgtacgcg
aaccggacggaggacgacatcctcctccgcgacgagctcgaccggtgggcggcggagtac
ccggacaggctcaaggtgtggtacgtcatcgaccaggtgaagcggccggaggaagggtgg
aagtacggcgtcgggttcgtcacggaggaggtgctgcgggagcacgtgccggagggcggc
gacgacacgctcgcgctcgcctgcgggccgccgccgatgatcaagttcgccgtctcgccg
aacctggagaagatgaagtacgacatggccaattctttcatcgtgttctaa

DBGET integrated database retrieval system