KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330881
Entry
4330881           CDS       T01015                                 
Name
(RefSeq) putative D-cysteine desulfhydrase 1, mitochondrial
  KO
K05396  D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00470  D-Amino acid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4330881
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    4330881
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     4330881
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4330881
NCBI-ProteinID: XP_015626189
UniProt: Q6ZHE5
LinkDB
Position
2:complement(32644973..32648499)
AA seq 426 aa
MARGAHQAPGGFWTVAAAPTRCSLPHSLPIPLHAAAAAAAWMAGVSAASAAGKIGSFLSK
RPYAPPSWASHLSPAPSQTFSLGHFPTPIHKWNLPNLPNGTEVWIKRDDISGMQLSGNKV
RKLEFLMADAVAQGADCVITVGGIQSNHCRATAVAAKYINLDCYLILRTSKLLVDKDPGL
VGNLLVERLVGAHIDLVSKEEYGKIGSVALADLLKKKLLEEGRKPYVIPVGGSNSLGTWG
YIEAIREIEHQIQISGDVQFDDIVVACGSGGTIAGLALGSKLSSLKAKVHAFSVCDDPGY
FHSYVQDLIDGLHSDLRSHDLVNIENAKGLGYAMNTAEELKFVKDIATATGIVLDPVYSG
KAAYGMLKDMGANPAKWEGRKILFVHTGGLLGLYDKVDELSSLSGSWRRMDLEESVPRKD
GTGKMF
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcgcgtggggcccaccaggcaccaggtgggttttggactgtagctgctgccccgacg
cgctgctcgctgccccactctctccccattcccctccacgccgccgccgccgccgccgcg
tggatggccggagtttccgccgcctccgccgccgggaagatcgggagcttcctctccaag
aggccgtacgcgccgccgtcctgggcctcgcacctgtcccccgccccctcgcagaccttc
tcgctcggccatttcccgacgccgatccacaagtggaatctgcccaatttgccgaatggc
acggaggtgtggatcaagcgagacgacatctcaggcatgcagttgagcgggaacaaggtc
cggaagctcgagttcctgatggcagatgccgtcgcgcagggcgctgactgcgttataact
gtaggtggcatccagagcaatcactgccgtgccaccgcagtggctgcaaagtatataaat
cttgattgttatctgatactgcgcacatccaagcttcttgtggataaggaccctggtttg
gttgggaatctccttgttgagagattggtgggagcgcatattgatcttgtttcaaaagaa
gaatatggaaaaattggcagtgtggctttagcggacttgctgaaaaagaagcttttggaa
gaaggccgaaaaccatatgttattcctgttggtggatcaaactctctaggaacttgggga
tatatagaagcaataagggagattgaacatcaaattcagatatcaggtgatgttcagttt
gacgacattgttgttgcatgtggcagcggtggaaccattgctggtcttgctttaggatca
aaattgagtagcttaaaggcaaaagtccatgctttctctgtttgtgatgatcctggatat
ttccattcctatgttcaagacctgattgatggacttcattctgatttgcgttcacatgat
ttagtcaacattgaaaatgctaagggcttaggttatgccatgaacacagctgaggagctt
aagtttgttaaagatatagctacagcaacaggcattgtccttgatccagtctacagtgga
aaggcagcatatggaatgctgaaagacatgggtgctaatccagctaagtgggaagggcga
aaaattctttttgtacatacaggtggtcttcttggtttgtatgataaggttgatgagtta
tcatctttgagtgggagttggcgcagaatggatcttgaagaatctgttccacgcaaagat
ggaactggtaagatgttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270375
Entry
9270375           CDS       T01015                                 
Name
(RefSeq) putative D-cysteine desulfhydrase 2, mitochondrial isoform X2
  KO
K05396  D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00470  D-Amino acid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    9270375
  09106 Metabolism of other amino acids
   00470 D-Amino acid metabolism
    9270375
Enzymes [BR:osa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     9270375
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 9270375
NCBI-ProteinID: XP_015621767
UniProt: B9EYZ1
LinkDB
Position
1:complement(28755759..28759337)
AA seq 407 aa
MRPSPALAGGGRTVANLLSATEWMLPSPATQVHTISVLPSHSPPSPPHHFAFSNLTTAPK
RNGGKGEEEGRPRFEVVRDDLLHPLANGNKARKLDALLPLLRRRGATDVVTCGGCQSAHA
AATAVHCAEWGMRPHILLRGEQPDIPTGYNLISLMFGNVAYASRSVYAHRDEMLYNHARK
VAGTGGTVLWADDISKEDFVLDEDNGCEIGSRRVVIIKEGAGDVQALLGVIRLVEYLYNL
SSFHKHENVHVVVDAGTGTTAVGLALGAVCLGLHWRVTAVMLADTLERYKEREKSLISDF
KKLCHNNYHEMVGENDIGDSLVEWVERFSPRRFGKVLNGEIALCRQIAQQTGILLDPMYT
LAGWEQAVDLCVGDSRTKVVMIHTGGTLGFCGLAQRYSSHFTSDEQT
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcggccatcgccggcgctcgccggcggcggcaggacggtcgcaaatcttctctccgcc
acggagtggatgcttccttctccggccacccaagtccacaccatctccgtcctcccctcc
cactcaccgccgtcccctcctcaccacttcgcgttctccaacctcaccaccgcgcctaag
cgcaacggaggcaagggggaagaggagggccgcccaaggttcgaggtggtgcgcgacgat
ctcctccacccgctcgccaatggcaacaaggcccgcaagctcgacgccctcctgccgctc
ctgcgccgccgcggcgctactgacgttgtgacttgtgggggttgccagagcgcccatgct
gcggccactgcggtccactgtgctgagtggggaatgaggccacacatattgctgagaggt
gaacagccagatatcccgacaggctacaatcttatctctttgatgtttggcaatgtggct
tatgcctctcggtcagtgtacgcacacagagatgaaatgctttacaatcacgccagaaaa
gttgcaggcacaggtggtacagtgttgtgggctgatgatattagcaaagaggattttgtt
ttagatgaagataatggttgtgaaattggttcgagaagagtagttattattaaggaaggg
gctggtgacgtccaagcattgctaggtgttattcggctagtggagtacctttacaatctg
tcgtcatttcataaacatgagaatgttcatgtcgtggtagatgctgggacaggcacaaca
gctgtggggttagctcttggagcggtatgtctaggattgcattggagagtaactgctgtc
atgcttgctgacacactcgaaagatataaagaacgagagaagtccttaatatctgacttt
aagaagctttgccataacaactaccatgaaatggtgggagaaaatgatattggtgacagt
ttagttgaatgggtggaacgattttcaccaagacgatttggcaaggtgctgaacggtgaa
attgcattatgccgccagattgcgcagcaaactggtatcctgttggatccaatgtacacc
ttagctggttgggagcaagctgtggatctatgtgttggagacagtagaaccaaagtggtg
atgatccatacgggaggaacgcttggcttctgcggattggcgcagcggtactcatcgcac
ttcacctcggatgagcaaacttag

DBGET integrated database retrieval system