KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330895
Entry
4330895           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4330895
   03420 Nucleotide excision repair
    4330895
   03430 Mismatch repair
    4330895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4330895
   03036 Chromosome and associated proteins [BR:osa03036]
    4330895
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330895
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4330895
  DNA Replication Termination Factors
   ELG1-RFC complex
    4330895
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4330895
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4330895
  Check point factors
   HRAD17(Rad24)-RFC complex
    4330895
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_11 AAA_assoc_2 AAA_22 AAA_16 AAA_5 AAA_30 ATPase_2 AAA_7 RuvB_N DUF815 AAA_14 AAA_19 AAA_24 AAA_18 bpMoxR DNA_pol3_delta ResIII AAA_3 TniB MCM ABC_tran TIP49 AAA_35 Mg_chelatase
Other DBs
NCBI-GeneID: 4330895
NCBI-ProteinID: XP_015627208
UniProt: Q6YZ54
LinkDB
Position
2:complement(32723404..32727553)
AA seq 361 aa
MAGATAATPMDIDAAAPPPGAAAKGKAPLSSTPGGRAAPWVEKYRPQSLGDVAAHRDIVD
TIDRLTNENRLPHLLLYGPPGTGKTSTILAVARKLYGSQYGNMILELNASDERGIDVVRQ
QIQDFASARSLSFGAKQSVKMVLLDEADAMTKDAQFALRRVIEKHTRSTRFALICNHVNK
IIPALQSRCTRFRFAPLDGTHVRERLKHIIQSEGLDVDDGGLTALVRLSNGDMRKALNIL
QSTHMASKQITEEAVYLCTGNPMPKDIEQIAYWLLNESFSTSFKCISDMKMRKGLALVDI
IREVTMFVFKIQMPSDVRIKLINDLADIEYRLSFACNDKLQLGALISTFTGARTAMVAAA
H
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcgggagccaccgccgccactccgatggacatcgacgccgccgcgccgccgccgggg
gcggccgccaagggcaaggcgcctctctcctccactcccggcggtagggccgcgccctgg
gtcgagaagtaccgcccccaatccctcggcgatgtcgccgcccaccgcgacatcgtcgac
accattgataggcttacaaatgagaacaggcttccacatttgttgctttatgggcctccg
ggcactgggaaaacatcgacaatactggccgttgcaaggaagttgtatgggtcacagtat
ggcaacatgattcttgaactcaatgcatcagatgagcgtggtattgatgttgtaaggcag
caaatccaagacttcgcaagtgcccgcagtctctctttcggagcaaagcaatctgttaag
atggttctattggatgaagcagatgccatgaccaaggatgcacagtttgcattgcgaaga
gtcattgagaagcatacaaggagcacaaggtttgcgctgatatgcaaccatgtgaacaaa
atcattccagcactgcaatcaaggtgcaccaggtttagatttgcaccccttgatggcact
catgttagggaacgtcttaaacatataatacaatccgaggggcttgatgtagatgacggt
ggtttgacagcccttgtgcggttaagtaatggtgatatgaggaaggctttgaacatattg
cagtcaacacacatggcatctaagcaaataacagaggaagctgtgtacctttgcacagga
aaccccatgccgaaagacattgaacagatagcatactggttgctgaatgaatcattttca
accagcttcaaatgtatatctgatatgaagatgagaaaaggactggccttggttgatatc
atacgggaggtcactatgtttgtgttcaaaatacagatgccatctgatgtacgcataaag
ctgattaatgatctggctgatatcgagtaccggctaagctttgcttgcaatgacaagtta
cagctgggggcgctgatatcaactttcacgggtgctcgcacggctatggttgctgctgcc
cactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334389
Entry
4334389           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4334389
   03420 Nucleotide excision repair
    4334389
   03430 Mismatch repair
    4334389
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4334389
   03036 Chromosome and associated proteins [BR:osa03036]
    4334389
   03400 DNA repair and recombination proteins [BR:osa03400]
    4334389
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4334389
  DNA Replication Termination Factors
   ELG1-RFC complex
    4334389
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4334389
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4334389
  Check point factors
   HRAD17(Rad24)-RFC complex
    4334389
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA Rad17 AAA_16 Sigma54_activ_2 AAA_5 DUF5906 RuvB_N DUF815 DNA_pol3_delta RsgA_GTPase ABC_tran Mg_chelatase AAA_22 Rep_fac_C AAA_29 AAA_2 AAA_24 FtsK_SpoIIIE TsaE RNA_helicase ATPase_2 T2SSE
Other DBs
NCBI-GeneID: 4334389
NCBI-ProteinID: XP_015630600
UniProt: Q852K3
LinkDB
Position
3:complement(32964606..32967806)
AA seq 354 aa
MLWVDKYRPKTLDKVTVHDQVAQNLKKLVAEQDCPHLLFYGPSGSGKKTLVMALIKQMFG
AGADKVKMENKTWKIDTGSRNIEIELAMLSSAHHVEMNPSDAGFQDRYVVQEVIKEMAKN
RPIDAKGKRAFKVLVLNEVDKLSREAQHSLRRTMEKYSASCRLILCCNSSSKVTEAVRSR
CLNVRVNAPSEDQIVQVLEFIGKKENLQLPFGFAARIAAQSNRNLRRAILFFETCKVQQY
PFTSNQVAPPLDWEQYVSEIAADIMKEQSPKRLFAVRQKFYELLVNCIPPESILKKLLAE
LLKKLDSDLKHEICHWAAHYEHKMRLGSKAIFHLEAFVAKFMSIYKEFLVSTFG
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgctgtgggtggacaagtacaggccgaaaaccctagacaaggtcaccgtccatgaccag
gtcgcgcaaaacctcaagaagctggtggcggagcaggattgcccgcacctgctcttctat
gggccgtcggggtccgggaagaaaaccctagtcatggccctcatcaagcagatgttcggc
gcaggcgcggataaggtgaagatggagaacaagacatggaagatcgatactgggtcgagg
aatattgagatagaactggcaatgttgtcgagcgcccaccatgtggagatgaaccccagc
gatgctgggtttcaggacaggtatgttgttcaggaagtcattaaagagatggcgaagaat
aggccaattgatgccaagggcaagagagcatttaaagtccttgtccttaatgaagtcgac
aagctctcacgagaagcccagcattcccttcgtaggacaatggagaagtacagtgcatca
tgcaggctgatattgtgctgtaatagctcatcaaaggtgacagaggctgtaaggtctcgt
tgcttgaacgtgcgagtgaatgcacccagtgaagaccagatcgtccaagttctggagttc
attgggaagaaagaaaatctgcagcttccatttggatttgctgctaggatagcagcacaa
tcgaaccgtaacctgagacgagcgatactgttttttgagacctgcaaagtccagcaatac
ccatttacatcaaatcaagtagcacctcctcttgactgggagcaatatgtgtcagaaata
gcagctgatatcatgaaagaacaaagccctaaaaggctatttgctgtgcgccagaagttc
tacgaattacttgtgaattgtatcccacctgaaagcatcttaaagaagttgttggcggag
ttactgaagaaattagactctgacttgaaacatgaaatttgtcactgggctgcacactat
gaacacaagatgcgtcttgggtccaaggccatttttcacctagaagctttcgtcgccaag
ttcatgagcatctacaaggaatttcttgtctctacatttggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336704
Entry
4336704           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4336704
   03420 Nucleotide excision repair
    4336704
   03430 Mismatch repair
    4336704
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4336704
   03036 Chromosome and associated proteins [BR:osa03036]
    4336704
   03400 DNA repair and recombination proteins [BR:osa03400]
    4336704
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4336704
  DNA Replication Termination Factors
   ELG1-RFC complex
    4336704
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4336704
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4336704
  Check point factors
   HRAD17(Rad24)-RFC complex
    4336704
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_22 AAA_16 Rad17 Mg_chelatase Viral_helicase1 AAA_5 AAA_11 AAA_25 AAA_24 AAA_19 AAA_assoc_2 AAA_30 RuvB_N RNA_helicase AAA_3 MeaB DEAD AAA_28 T2SSE ABC_tran bpMoxR DUF2075 AAA_18 NTPase_1 DUF6120 IstB_IS21 DNA_pol3_gamma3 MCM KTI12
Other DBs
NCBI-GeneID: 4336704
NCBI-ProteinID: XP_015637148
UniProt: A0A0P0WDN8
LinkDB
Position
4:28597312..28600305
AA seq 335 aa
MDASSSSAPDLADAYDIPWVEKYRPTRVADVGGNSDAVARLQVIARDGNMPNLILSGPPG
TGKTTSILSLAHELLGPSYREAVLELNASDDRGLDVVRNKIKMFAQKKVTLQPGRHKIVI
LDEADSMTSGAQQALRRTMEIYSNTTRFALACNTSSKIIEPIQSRCAIVRFSRLSDQEIL
GRLMIVVAAEKVPYVPEGLEAIIFTADGDMRQALNNLQATVSGFRFVNQENVFKVCDQPH
PLHVKNMVKNVLDGKFDEACSALKQLYDLGYSPTDIITTLFRVIKNYDMAEYLKLELLKE
TGFAHMRICDGVGSFLQLSGLLAKFALVRETAKAS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggacgcctccagctcctccgcccccgacctcgccgacgcctacgacatcccgtgggtg
gagaagtaccgccccacccgcgtcgccgacgtcggcggcaactccgacgccgtcgcccgc
ctccaggtcatcgcccgcgacggcaacatgccaaacctaatcctctccgggcctccgggc
accgggaagactacgagcatcctgtcgctggcacacgagctgctcggacctagctaccgc
gaggccgtgctcgagctcaatgcctcggacgacaggggcctggatgtggtgcggaacaag
atcaagatgtttgcgcagaagaaggtcacgctgcagccggggaggcacaagatcgtcatc
ttggatgaggctgacagcatgacatcgggagcacagcaagcactgagacgaacaatggag
atttattctaacaccacaaggtttgcgcttgcatgcaacacttcatctaagatcattgaa
cccattcaaagccgttgtgctattgtacggttctcaaggctttcagatcaggagattctt
ggccgactcatgattgtggtagcagctgagaaggttccttacgtgccagagggacttgaa
gctatcatctttactgctgatggtgacatgaggcaagctttgaacaacttgcaagctaca
gttagtgggttccgttttgttaatcaagaaaatgtgttcaaggtgtgtgatcaaccacat
ccgttgcatgtcaagaatatggtgaaaaatgtgcttgatggaaagtttgatgaggcttgc
tctgctctgaagcaattatatgatttgggctactctcccactgacataatcactactctc
ttccgggttatcaagaactacgacatggctgaatatctgaagctggaattgttgaaggaa
accggatttgctcacatgagaatctgcgatggtgttggctcatttcttcaattatcaggc
cttctggcaaagtttgcgttggtgagagaaacagcaaaagcatcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349480
Entry
4349480           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4349480
   03420 Nucleotide excision repair
    4349480
   03430 Mismatch repair
    4349480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4349480
   03036 Chromosome and associated proteins [BR:osa03036]
    4349480
   03400 DNA repair and recombination proteins [BR:osa03400]
    4349480
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4349480
  DNA Replication Termination Factors
   ELG1-RFC complex
    4349480
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4349480
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4349480
  Check point factors
   HRAD17(Rad24)-RFC complex
    4349480
SSDB
Motif
Pfam: DNA_pol3_delta
Other DBs
NCBI-GeneID: 4349480
NCBI-ProteinID: XP_015613745
LinkDB
Position
10:complement(22819216..22822999)
AA seq 564 aa
MAPPATTLSDALDHDRRRDARRYRTFLPPSQLVLGLHRLGFACIPRSGAPLTRPRTAPSS
VPHQPPPRREAPQPQVANAAVAERRPLREREEAAAAAAAAAKRIHDHHTPAESKAEAASE
PQVSAGDHSTQSSDHSASAVAVGRGGSIWVRVLPKSVAMVDSPQTSEESTPTAEDKYIWA
DKYRPNFLNDFICNKDAALELYNQVTAQECNHIIFEGPTSVGKRSMVSALIWDAFATDNL
KIEEQTKRFELKGEIAKHIDIRVKISSHHVEVNLADIHGYEKHVITTLLNESIPSPNSIC
SHANCRVIVVHDADKLSSDLQHYIGWFLGRYVGCNKIMFCCSDASNLEAVRHLCKVVTLK
PPSSDEIIKVLEYIAVQESIDLPRDIARRITMSSGNNLRQAIRSFEATWKANYAFLEGHA
ILTGWEEEISNVAKKILEEPSPKQLYVIRGKIRKLIEHNVSPYFIFSNLVAELKRDRDEE
FQNSIDQLASELNHIKDCARQKEQCESGDTGLEIRNINIEGFAKEGHDQRETIQCFIKIE
EFTVRFMGFYRSLKAKNMNRGGVL
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggctcccccggccaccaccctctccgacgcgctcgaccatgaccgccgccgcgacgcc
cgacgctaccgtaccttcctgccgccgtcgcagctcgtgctcggtctccaccgcttgggc
ttcgcttgcatccccagaagcggcgcccccctcacccgcccccgcaccgcccctagctcc
gtgccccaccaaccgccgccgcgccgggaggcgccccagccgcaggtagccaatgccgcc
gtcgccgagaggaggcctttgagggagagagaggaagccgccgccgccgccgccgccgcc
gccaaacgcatccacgaccaccacacgccggctgaatccaaagctgaagctgcttctgag
ccacaagtgtccgccggcgaccacagcacgcagagctccgaccacagcgcctccgccgtc
gccgtcgggagaggagggagcatctgggtccgggttttgcccaaatcggtcgccatggtg
gattcgccacagacttctgaagaatccacacccacggcagaggacaagtacatctgggca
gacaagtatcgccccaatttcctcaacgatttcatctgcaacaaggacgctgcccttgag
ctctacaaccaggttaccgcacaagaatgcaaccatatcatatttgaaggcccgacctcc
gtcggaaagaggagcatggtgtcggcactcatatgggatgcttttgctactgataatctc
aagatagaggaacagacaaagagattcgagctgaagggagaaattgcaaaacacattgat
atcagagtgaagatttcaagtcatcatgtggaggtaaatttggctgacatacacggctat
gagaagcatgtcattactactttgttgaatgaatccatcccatcaccaaactccatttgc
agtcatgccaactgcagagtgatcgtcgtccacgacgctgataaactctcatctgatctt
caacattatattggatggtttctggggaggtatgtaggatgcaataaaatcatgttctgc
tgttctgatgcttcaaaccttgaggctgtcaggcatctctgcaaggttgtgacacttaag
ccaccttcatctgatgagataatcaaggtcctagagtacattgcagtgcaagagagcata
gatctgcctcgtgatattgctaggagaataacaatgagctcaggcaataatctccgacag
gcaatacgttcttttgaagctacttggaaagcaaactatgccttcctagaaggccatgcc
attttgacaggatgggaagaggaaatctccaatgtagccaaaaaaatcttggaggaacca
agcccaaaacagctgtatgtcattaggggtaagatcagaaaactgattgaacataatgtg
tcaccttacttcattttctctaatctggttgctgaactgaaaagggacagggatgaggag
ttccaaaatagcattgatcaactagcatcggagttgaaccatatcaaagattgcgcgcgt
caaaaagagcagtgcgaatccggcgacacgggtttggaaatcagaaacataaatatagaa
ggttttgccaaggagggccatgaccaacgcgaaactatccaatgctttataaagattgaa
gagttcactgtgaggttcatgggcttctacagatctttaaaagcaaagaacatgaataga
ggaggtgttctataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350754
Entry
4350754           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 1
  KO
K10754  replication factor C subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4350754
   03420 Nucleotide excision repair
    4350754
   03430 Mismatch repair
    4350754
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4350754
   03400 DNA repair and recombination proteins [BR:osa03400]
    4350754
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4350754
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4350754
SSDB
Motif
Pfam: RFC1 BRCT AAA Rad17 AAA_30 AAA_22 DNA_pol3_delta PTCB-BRCT RuvB_N AAA_16 AAA_5 AAA_assoc_2 Sigma54_activ_2 BRCT_2 Zeta_toxin AAA_24 AAA_17 RNA_helicase AAA_18 GREB1_C RsgA_GTPase NTPase_1 AAA_33 AAA_14 Mg_chelatase TsaE AAA_19
Other DBs
NCBI-GeneID: 4350754
NCBI-ProteinID: XP_015617630
UniProt: Q2R2B4
LinkDB
Position
11:21443057..21452911
AA seq 1021 aa
MSSDIRKWFMKAQDKNGGAAKPAGTTALAKKPVLSIPEKPSAAPSMAACDQDCSARRKTS
KYFASKTEKEEDTSAGKGTGRGLPKRKLQKVSDELEDDMKPLPAKEVHKEEEDDDDDDFV
APSKRKTPVKPPPSKKLKGASTAEAHGKTGLDDDNEDKMDEDAKTPSKASGSGRGRGRGR
GRGGRGAGAAHGKTIGLDDDGEEDKMDEDAKTPSKAAGRGRGGASGGRGRGGGGRGFMNF
GERKDPPHKGEKEVPEGAPDCLTGLTFVISGTLDSLEREEATDLIKRYGGRVTGSISKKT
NYLLADEDVGGVKSNKAKELGVPFLTEDGLFDMIRKSKPAKATVAKHQSDKNSEKQQKSP
MKSSPVKVERRDGNQITTGKNISPKSNKGSASIDNQKVNIVDRGSLQWTEKYRPKVPNDI
VGNQSMVKQLHDWLRSWEDQFLHSGQKGKGKKQADSGAKKAVLLSGPPGIGKTTTAKVVS
QMLGLQAIEVNASDSRGKADSKIEKGVGGSTSNSIKELISNATLNYSNNRLKRPKAVLVM
DEVDGMSAGDRGGVADLIASIKMSKIPIICICNDRYSQKLKSLVNYCLLLNFRKPTKQQM
GKRLMEIAKKEGLQAQENAMEELAERVHGDIRMALNHLQYMSLSQSVVKYDDIRQRLNSS
TKDEDISPFTAVDKLFGFNGGRLRMDERIDLSMSDPDLVPLIIQENYINYRPITVGKDDS
GVKRMNFLARAAESIADADIVNVQIRRYRQWQLSQAACLSSSIVPAALMHGNREILEAGE
RNFNRFGGWLGKYSTTNKNIRLLEDAHSHILASQQANLDRESLRLDYLTLLLRQLTDPLK
TMPKDEAVQKVVEFMDTYSLSQEDFDTIVELSKFKGHPNPMDGIQPAVKSALTKAYKQGS
SSRVVRAADLVNIPGMKKPLKKRVAAILEPVGESLPEENGVASSEGDEEDSSDAENNDEL
VPGDTKPKLDLQSDKKKGIQVQLDLKSNGNGLNSKKMPAGRSKASGSAGKAAGGSGGKRK
R
NT seq 3066 nt   +upstreamnt  +downstreamnt
atgtcttcggacatcaggaaatggttcatgaaggcgcaggacaagaatggtggcgcagcg
aagccggctgggacgacggcgttggcgaagaagcccgtgctcagcattccggagaagccg
tcggcggcgccatctatggcggcttgtgatcaagattgttcagctagaaggaagactagc
aagtactttgcatccaaaacagaaaaggaggaagacaccagtgcaggaaaaggtaccggg
agaggtttgcctaaaagaaaacttcagaaagtcagtgatgagcttgaggatgacatgaag
cctttgccagcaaaggaagtccataaagaagaagaagatgatgatgacgacgactttgtg
gcaccttcaaaaaggaaaactccggtgaagccaccaccatcaaagaagttgaagggtgca
tctactgctgaagctcatggaaagactggtcttgatgatgataacgaggacaagatggat
gaagacgctaagaccccttccaaggcatctggaagtggaaggggaaggggaagggggaga
gggaggggaggaagaggagcaggagcagcccatggaaagacaattggtcttgatgacgac
ggtgaggaggataagatggatgaagatgccaagaccccttccaaagcagctggaagggga
aggggaggagcctctgggggaagagggagaggagggggtgggagaggcttcatgaacttt
ggtgaaaggaaggatcctcctcacaaaggggagaaggaagtcccggagggtgcccctgac
tgtttaactggtttgacatttgtcataagtggcactcttgacagtcttgaacgtgaggag
gcaactgatctaatcaagcgttatggaggccgtgtgaccggctctattagcaaaaagacg
aattacctattggctgatgaagacgttggtggagtgaaatcaaataaagcgaaagaactg
ggcgtcccattcctaactgaagatggtttatttgatatgattcggaaatcaaagcctgca
aaggctactgtggcaaaacatcaaagcgacaaaaattcagaaaagcagcaaaaatcacca
atgaagagttctccagttaaagttgaaagaagagatggtaatcaaattaccacaggcaaa
aatatttcaccaaagagtaataaaggaagtgcctccattgacaaccaaaaggtcaacatt
gttgaccgtggttctttgcaatggactgaaaagtatcggcccaaagttccaaatgacata
gttgggaaccaatcaatggttaaacagcttcatgattggttgagaagttgggaggaccaa
ttccttcattctggccagaagggtaagggaaagaagcaggctgatagtggagctaaaaag
gctgtgttgttgagtggacctccaggtattggtaagaccacaactgctaaagttgtcagt
cagatgcttggattgcaggctattgaggttaatgcaagtgatagccgtggtaaggcagac
tctaagattgagaaaggtgttgggggcagtacatcaaattctatcaaagagcttattagt
aatgcaactctgaattatagtaacaaccgattaaaacgacccaaggctgtactagtcatg
gatgaagttgatggtatgtctgctggagatcgtggtggtgttgctgatcttattgctagc
attaagatgtccaagattcctataatttgcatttgcaatgaccgttatagccagaaattg
aagagccttgtaaattactgcttgctactcaacttcagaaaaccaaccaagcaacagatg
ggtaagaggttgatggaaattgccaagaaggaaggtcttcaagctcaagagaatgcaatg
gaagaacttgcagaaagagtacacggggatattcgcatggctcttaaccatttgcaatat
atgagcctctcccagtccgtggtcaaatatgatgatataagacagcgacttaatagtagc
acaaaagatgaagatatttcccccttcacggctgttgacaagctgtttggttttaatggt
gggagactacggatggatgagagaattgatttgagcatgagcgatcctgatttagtccct
ctgattatccaggaaaactatatcaattatcggcctatcactgttgggaaggatgacagt
ggagttaaaagaatgaattttcttgctcgtgctgctgaatctatagcggacgctgatatt
gttaatgtacaaataagaagatatcgacagtggcaattgtcccaagctgcttgtttgtct
tcatctatagttcctgctgctttgatgcatgggaatagagagatccttgaagcaggtgag
cgaaacttcaataggtttggtggatggttgggaaagtactcgaccacaaataaaaacata
aggctactggaagatgcccatagtcatattcttgcctcccagcaagcaaatttggacagg
gagtcattgaggctggattacctcactcttctcttgagacaattgactgatccactgaag
acaatgcccaaggatgaagctgtgcaaaaagtggtggagtttatggatacctactcttta
agccaggaagactttgacacaattgttgaattatcaaaatttaagggtcatccaaatcct
atggatggtattcaaccagctgttaaaagtgccttaacaaaagcatacaaacaaggaagt
agttctcgtgttgttcgagcagcagatctagtaaatatcccaggcatgaaaaagccatta
aagaaacgagtggcagcaatccttgagccagtgggagagagtttgcctgaagaaaatgga
gtagcgtcatctgaaggcgatgaagaggattcctctgatgctgaaaataatgatgaactg
gtgcctggtgacacaaaaccaaaactggacctgcagagtgataagaagaaagggatccaa
gtgcagctcgacctgaagagcaatggcaatggcttgaactcgaagaagatgccggctggt
agatcaaaagcttctggctctgctgggaaggctgctggaggctcaggtgggaagaggaag
aggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351654
Entry
4351654           CDS       T01015                                 
Name
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4351654
   03420 Nucleotide excision repair
    4351654
   03430 Mismatch repair
    4351654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4351654
   03036 Chromosome and associated proteins [BR:osa03036]
    4351654
   03400 DNA repair and recombination proteins [BR:osa03400]
    4351654
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    4351654
  DNA Replication Termination Factors
   ELG1-RFC complex
    4351654
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    4351654
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     4351654
  Check point factors
   HRAD17(Rad24)-RFC complex
    4351654
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_22 Rad17 RuvB_N Mg_chelatase AAA_16 AAA_assoc_2 AAA_14 AAA_24 ResIII AAA_5 AAA_11 DNA_pol3_delta PhoH AAA_19 DUF2075 AAA_23 AAA_25 AAA_30 AAA_7 IstB_IS21 bpMoxR AAA_18 RNA_helicase AAA_28 DUF3853
Other DBs
NCBI-GeneID: 4351654
NCBI-ProteinID: XP_015618344
UniProt: Q9FXM3
LinkDB
Position
12:3873310..3877273
AA seq 339 aa
MAPLVPSSQPWVEKYRPRQVKDVAHQEEVVRVLTTTLQTADLPHMLFYGPPGTGKTTTAL
AIAYQLYGPELYKSRVLELNASDDRGINVVRTKIKDFAAVAVGSARKGGYPCPPYKIIIL
DEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSN
RILHICNEEGLSLDAQALATLSTISNGDLRRAITYLQSAARLFGSSISSTDLISVSGAIP
EDVVKSLLASCKSGEFDVANKEVNNIIADGYPVSQLISQFLDVIVNADDIPDEQKARICK
KLGEADKCLVDGADEYLQLLDVASETIRALFDMPQTLVF
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcgccgctcgtgccgtcctcgcagccatgggtggagaaataccggccgaggcaggtg
aaggatgtcgcgcaccaggaggaggtggtccgggtgctcaccaccaccctccagaccgcc
gaccttccgcacatgctgttctacggcccgcctggcaccgggaagaccaccaccgcgctt
gccattgcttaccagctctacggtccagagctctacaagtcaagagttctagaacttaat
gctagtgatgatcgtggaattaatgtggtgaggactaagatcaaggactttgctgctgtt
gctgttggttctgcacgaaaaggcggttatccctgcccaccatacaagattattatacta
gatgaagcagattcgatgacagaagatgcccagaatgctttaaggcgtactatggagact
tactccaaagtgacaagattctttttcatatgcaattacatcagcaggataatagaacca
cttgcatcaagatgtgcaaagtttagattcaagcctctttcagaagaagtaatgagcaat
cgcattttgcatatatgcaatgaagaagggctcagtcttgatgctcaggcattggctaca
ctaagcaccatctctaatggtgacctccgccgtgctataacctatcttcagagcgctgct
cgcttatttggatcttctatttcttctactgacttgattagtgtttcaggggctatccct
gaagacgttgtcaagtcattgcttgcatcttgcaaatctggtgaatttgatgtggcaaac
aaggaagtcaataatattattgcagatggataccccgtttcacagttgatctcacagttt
ctagatgtgatagttaatgccgatgatattccagatgagcagaaggcaagaatatgtaaa
aagcttggggaagcagataagtgcttggtcgatggagcggatgagtatttacagcttttg
gatgtggctagtgagactatccgtgctctttttgacatgccacaaacgctggtcttctaa

DBGET integrated database retrieval system