KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330902
Entry
4330902           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit A
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4330902
   03420 Nucleotide excision repair
    4330902
   03430 Mismatch repair
    4330902
   03440 Homologous recombination
    4330902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4330902
   03032 DNA replication proteins [BR:osa03032]
    4330902
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330902
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4330902
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4330902
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4330902
   MMR (mismatch excision repair)
     4330902
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4330902
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N tRNA_anti-codon CDC24_OB3
Other DBs
NCBI-GeneID: 4330902
NCBI-ProteinID: XP_015625818
UniProt: Q6YZ49
LinkDB
Position
2:complement(32832938..32836475)
AA seq 656 aa
MAMARLTPNGVAAALAGDTNLKPVLQIVELRGVQVNGAGVTRGERFRAVVSDGTAASSAL
FAAQLSDHARSGALRRGSIVQLSEYVINEVGPRRIIVILNLEVLVSECEIIGNPTALSET
GSPIPNPTRVEQFNGAPQYGLMAGNSSNTTTKPSDNVPLFQNSMAGNSSNFATRPSDKVP
VFQPTVQPSYRPAPNYKNHGAIMKNEAPARIIPISALNPYQGRWAIKARVTAKGDIRRYH
NAKGDGKVFSFDLLDSDGGEIRVTCFNALLDRFYEVVEVGKVYVVSRGNLRPAQKNYNHL
NNEWEILLENGSTVDLCPDENSSIPTQRFDFRPINEIEDAQNNAILDIIGVVTSVNPCTT
IQRKNGMETQKRTMNLKDMSGRSVEVTMWGDFCNREGSQLQGMVERGIFPVLAVKAGKVS
DFSGKSVGTISSTQLFINPDSAEAHSLRQWFDSGGRDASTQSISRDITPGASRNEIRKTV
AQIKDEGLGMGDKPDWITVKATVIFFKNESFFYTACPNMIGDRQCNKKVTKSTNGNWTCD
KCDREFEECDYRYLLQFQIQDHSGTAWVTAFQEAGQELLGCSATELNALKEREDPRFADT
MLNCLFQEYLLRLKVKEESYGDERKVKNTAVKVEKVDPSGESKFLLDLISKSSALH
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggcgatggcgaggctgacgccgaacggcgtggcggcggcgctggcgggggacacgaac
ctgaagccggtgctgcagatcgtcgagctgcggggcgtccaggtcaacggcgcgggcgtc
acgcgcggggagaggttccgggcggtggtctccgacggcaccgccgcgtcctccgcgctc
ttcgccgcgcagctcagcgaccacgcccgatccggcgccctccgacgcggcagcattgtg
cagctcagcgagtacgtcatcaacgaagtcggccccagaaggattattgtcattctgaac
ctggaagttcttgtttcggagtgtgagataattgggaatcctacagcgctttcagaaact
ggatctcctatcccaaatccgacaagagtagagcaatttaacggagcacctcaatatggt
ttgatggcagggaactcatcaaatacaaccacaaagcctagtgacaatgttccattgttc
caaaattcgatggcaggaaactcctctaactttgccactaggcccagtgacaaagttccg
gtcttccaaccaacagtccagccatcttatcgccctgcacctaattacaaaaaccatgga
gcaatcatgaaaaatgaagcccctgctagaataatccccatatctgctttaaatccttat
caaggccgctgggctatcaaggctagagttactgccaagggagatatccgccgataccat
aatgctaaaggtgatgggaaagtattctcttttgacttgcttgattctgatgggggagag
atacgggtgacatgcttcaatgctcttcttgatcgattctatgaagttgtggaagttggt
aaggtctatgtggtatcaagaggaaacttgagacctgcacagaagaactataaccatctt
aacaatgagtgggagattttattggagaatggatcaactgtggatctttgtcctgatgag
aacagttccattcccacccagcggtttgacttcagaccgatcaatgaaattgaggatgcc
cagaacaatgctatccttgacatcataggtgttgttacatcggtcaatccttgcaccaca
atacagaggaaaaatggcatggaaactcagaaaagaactatgaacctgaaggatatgtct
ggtcgaagtgttgaggtaaccatgtggggtgacttttgcaacagagaaggctcacagctt
caaggaatggttgaacgtgggatctttcctgtgctggctgtcaaagcaggaaaagtgagt
gatttcagtggcaagtctgtcggcacaatttcttcaactcagctcttcatcaaccctgat
tctgctgaagctcatagtctcaggcaatggtttgatagtggaggaagagatgcttctact
cagtccatatccagagatatcacgcctggagcatcaaggaatgagatccgaaagacagta
gcacagatcaaggatgaaggtcttggaatgggggacaaacctgactggattacggtgaaa
gccaccgttatattcttcaagaatgagtccttcttctacacagcttgccctaacatgatt
ggcgacaggcagtgcaataagaaggtgacaaagagtactaatggcaattggacctgtgac
aaatgcgatagggagtttgaagagtgcgactacaggtatctcctgcagtttcagattcaa
gatcactcgggaacagcttgggtgacagcattccaggaggctgggcaggagttgcttggc
tgctcggcaacagagctcaacgcacttaaggagcgcgaggaccctcggtttgcagacacc
atgctcaattgcttgtttcaggaatatctgctcaggctgaaggtcaaagaagaatcatac
ggcgatgagcgcaaagtgaagaacaccgcggtcaaagtggagaaggttgatccttcgggt
gaaagtaaatttctgctggatttgatctccaagtcctcggcgctacattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332052
Entry
4332052           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit B
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4332052
   03420 Nucleotide excision repair
    4332052
   03430 Mismatch repair
    4332052
   03440 Homologous recombination
    4332052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4332052
   03032 DNA replication proteins [BR:osa03032]
    4332052
   03400 DNA repair and recombination proteins [BR:osa03400]
    4332052
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4332052
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4332052
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4332052
   MMR (mismatch excision repair)
     4332052
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4332052
SSDB
Motif
Pfam: Rep_fac-A_C Rep-A_N REPA_OB_2 tRNA_anti-codon DUF223 BRCA-2_OB3
Other DBs
NCBI-GeneID: 4332052
NCBI-ProteinID: XP_015628911
UniProt: Q10Q08
LinkDB
Position
3:5979571..5983095
AA seq 630 aa
MDSDAAPSVTPGAVAFVLENASPDAATGVPVPEIVLQVVDLKPIGTRFTFLASDGKDKIK
TMLLTQLAPEVRSGNIQNLGVIRVLDYTCNTIGEKQEKVLIITKLEVVFKALDSEIKCEA
EKQEEKPAILLSPKEESVVLSKPTNAPPLPPVVLKPKQEVKSASQIVNEQRGNAAPAARL
AMTRRVHPLISLNPYQGNWIIKVRVTSKGNLRTYKNARGEGCVFNVELTDVDGTQIQATM
FNEAAKKFYPMFELGKVYYISKGSLRVANKQFKTVHNDYEMTLNENAVVEEAEGETFIPQ
IQYNFVKIDQLGPYVGGRELVDVIGVVQSVSPTLSVRRKIDNETIPKRDIVVADDSSKTV
TISLWNDLATTTGQELLDMVDSAPIIAIKSLKVSDFQGLSLSTVGRSTIVVNPDLPEAEQ
LRAWYDSEGKGTSMASIGSDMGASRVGGARSMYSDRVFLSHITSDPNLGQDKPVFFSLNA
YISLIKPDQTMWYRACKTCNKKVTEAIGSGYWCEGCQKNDAECSLRYIMVIKVSDPTGEA
WLSLFNDQAERIVGCSADELDRIRKEEGDDSYLLKLKEATWVPHLFRVSVTQNEYMNEKR
QRITVRSEAPVDHAAEAKYMLEEIAKLTGC
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggattccgacgcggcaccgtcagtgacgccgggggcggtggcgttcgtcctggagaac
gcgtcgccggacgcggccaccggcgtgccggtgccggagatcgtcctccaggtcgtcgac
ctcaagcccatcggcacccgcttcactttcttggcgagcgatggcaaggacaagataaag
acgatgcttctcacccagctcgctccggaggtgcgctccggcaacatccagaatctcggc
gtcatccgcgtcctcgactacacctgcaacaccatcggcgaaaagcaggaaaaggtcttg
attatcacgaagctcgaggtcgtgttcaaggcgctggattccgagatcaagtgcgaggcc
gaaaagcaagaggagaagccggcgattctgttgagtcccaaggaggaatccgtggttctc
tccaagcccacgaacgcgccgccacttcctccggttgtgctgaagcccaagcaggaggtg
aagtccgcgtcccagatcgtgaacgagcagcgcggcaatgctgctcctgcggcgcggttg
gccatgacgagaagagttcatcctttgatctccctgaacccctaccagggcaactggatc
atcaaggtgcgtgtcacaagcaagggcaacctgaggacgtacaagaatgctcgtggtgaa
ggctgcgtcttcaatgtggagctcactgatgtggatggcacccagatccaggcaaccatg
ttcaacgaggctgccaagaagttctatccgatgtttgagctggggaaggtgtactacatc
tccaaaggatctctcagagtcgccaacaagcagttcaagactgtccataatgactacgag
atgaccctgaatgagaatgctgttgttgaggaagctgagggcgaaacttttatcccacag
attcagtacaactttgtcaagattgatcagctagggccatatgttggtggcagggagcta
gtagatgttattggggttgttcagagcgtatctcctactcttagtgttaggaggaagatt
gacaacgagacgattccaaagcgtgacatcgttgtagcggatgactcgagcaaaactgta
accatatctctttggaatgatcttgccacaactactggtcaggagctcttggacatggta
gactctgcgcctatcattgcgataaagagcctaaaagtatctgacttccaaggtttgtct
ctgtcaactgtggggagaagtacaattgtagtgaatcctgacttgcctgaggcagaacag
ctcagagcttggtatgactctgaaggcaagggtacttcaatggcatcaattggttcagat
atgggcgcatcaagggttggtggcgcgagatccatgtacagtgatagagtttttctgtct
cacatcacaagtgaccccaacttgggtcaggataagcctgtgttcttcagtctgaatgcc
tatattagccttatcaagcctgaccaaaccatgtggtaccgagcttgcaagacctgcaac
aagaaggtgactgaggcaattggatcaggatactggtgtgaagggtgccagaagaatgat
gctgagtgctcactgaggtacatcatggtcatcaaggtctccgaccctactggtgaggcc
tggctttctctgttcaatgatcaggcagagaggattgttggctgcagtgcagatgagctt
gatcggattaggaaggaggagggtgatgacagttaccttctcaagctgaaggaagctact
tgggttcctcacctgttccgcgtcagcgtaactcagaatgagtacatgaatgagaagagg
cagaggatcactgtgaggagtgaagctccggtagaccacgcagctgaagccaagtacatg
ctcgaggagatagccaagctgacaggttgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337594
Entry
4337594           CDS       T01015                                 
Name
(RefSeq) replication protein A 70 kDa DNA-binding subunit C
  KO
K07466  replication factor A1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
osa03420  Nucleotide excision repair
osa03430  Mismatch repair
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4337594
   03420 Nucleotide excision repair
    4337594
   03430 Mismatch repair
    4337594
   03440 Homologous recombination
    4337594
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4337594
   03032 DNA replication proteins [BR:osa03032]
    4337594
   03400 DNA repair and recombination proteins [BR:osa03400]
    4337594
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    4337594
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    4337594
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     4337594
   MMR (mismatch excision repair)
     4337594
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     4337594
SSDB
Motif
Pfam: Rep_fac-A_C REPA_OB_2 Rep-A_N zf-CCHC tRNA_anti-codon zf-CCHC_2 DUF5521 zf-CCHC_5 UPF0515
Other DBs
NCBI-GeneID: 4337594
NCBI-ProteinID: XP_015638722
UniProt: Q65XV7
LinkDB
Position
5:593325..597985
AA seq 951 aa
MEPQLTPGAVQAIAEHPDGTGTIQPVLQVVDVRPVTTKNAPPTPKPAERFRMMLSDGVNT
QQSMLATALNPLVKDATLRPGTVVQLTDFMCNTIQGKRIIIVVKLDVLQNDCIVIGNPKH
YEPKSLTKEQDPNLQASVAQTNNGTYSGGASMLGPSVAPRAEQAASNSSYGGPYNSAQGM
LGSSIGRTVEPGPANVSAVGSYGAISAQNTTNANMMQPTSQLNIMNANTMQPTSQLNTMN
ANTMQPTSQLSSLNPNQNQRFAAPASGGVFGPPGNAYGQPSRPSYQQPPPVYMNRGPASR
NDSATRIIPITALNPYQPKWTIKARVTAKSDIRHWSNARSSGTVFSFDLLDAQGGEIRAQ
CWKESADKFFGQIEVGRVYLISRGSLKPAQKKYNTLNHDYEITLDIGLSTVEVCSDDDNS
IPRLQYNFRQISELENMANETIVDLLGVVTSVSPSATIMRKIGTETRKRSIQLKDLSGRS
IEVTLWGNFCDAEGQQLQLQCDSGSNPIIAFKGARVGDFNGKSVSTIGSTQLIINPDFPE
VERLRQWYMTEGKTAPCISLSREMLNMGRTDARKTIAQIKDENLGRLEKPDWITVKAAIS
HVTTESFCYPACPKLLPVGRQCNKKAINNGDGMWHCDRCDESFQNPEYRYMLRFQIQDHT
GSTYASAFDEAGEQIFGRKAGELFSIRNVDQDDAQFAEIIEGVRWHLYLFKLKVKEETYN
DEQSLKCTAVKVEKLDPSKESNVLLGAIDNLLLDPKGQSDLAPNAGFTDPVGGHGAPTSS
NAYAMNTGGVNQFGQQASISAGMSTPLAATRNLQTCSICGANGHSAQICHVGADMDMQET
SAGGSSMGNYNSIAGNGSSECYKCKQPGHYARDCPGQSTGGLECFKCKQPGHFSRDCPVQ
STGGSECFKCKQPGHFARDCPGQSTGAQHQTYGNNVAASRGYNRQSFVGGY
NT seq 2856 nt   +upstreamnt  +downstreamnt
atggagccgcagctgacgccgggggcggtgcaggcgatagcggagcacccggacgggacg
gggacgatccagccggtgctgcaggtggtggacgtgcggcccgtcaccaccaagaacgcg
ccgcccacgcccaagcccgccgagcgcttccggatgatgctctccgacggcgtcaacacg
cagcagtccatgctcgccaccgccctcaaccccctcgtcaaggacgccacgctccgcccc
ggcaccgtcgtccagctcaccgacttcatgtgcaacaccatccagggtaaaaggattatt
attgttgtgaaacttgatgttctgcaaaatgactgcattgtaattgggaaccctaaacac
tatgaaccaaagagtctaactaaggagcaagaccctaacttacaggccagtgtggctcaa
accaataatggaacctattctggtggcgcaagcatgctgggcccctccgttgcgccaagg
gcagagcaggctgctagcaacagttcatatggtggaccttataatagtgctcaaggaatg
ttgggttcttctattggcaggacagttgaacctggtcctgcaaatgtttctgctgttggc
tcttacggtgcaatatcagcacagaacacaacgaatgccaacatgatgcagcctacatct
cagctgaacataatgaatgccaacacgatgcagcctacatctcagctgaacacaatgaat
gccaacacgatgcagcctacatctcagctgtcctcgttgaaccctaatcaaaaccaaagg
tttgcagctcctgcttcgggtggagtctttggccctcctggcaatgcttatgggcagcct
tcacgtccttcatatcagcagccacctccagtgtatatgaatagagggcctgcctctagg
aatgactctgcaactcgtatcatcccaattaccgcgttgaatccataccagcctaagtgg
acaatcaaggcaagggtgacagcaaagtctgatatcaggcattggagcaatgccaggagt
tcaggaacagttttctcgtttgatcttcttgatgcacaaggtggagaaattcgtgcacaa
tgctggaaagaatcggctgataagttttttggccaaattgaggttggtagggtgtatttg
atatctagaggatcactgaagcccgcccagaagaagtataacactttgaaccatgattat
gaaataactctggatatcgggttatcaactgtcgaggtttgctctgatgatgataacagc
atccccaggctgcagtacaatttccggcagatcagcgaactagagaatatggctaacgag
accattgttgatttacttggtgttgttacatcagttagcccttctgcaacaataatgagg
aagatcggcactgaaacccggaaaaggtctattcaactgaaggacttgtctggccggagc
attgaagtaacattatggggaaacttctgtgatgctgagggtcagcagttgcagttgcag
tgtgattctggttcgaaccctataattgcttttaaaggtgcccgtgtgggtgattttaat
ggcaaatcagtgagcacaattggttcaacccagttaattataaatccagactttcctgag
gtggaaaggctgaggcagtggtacatgacagaaggaaaaactgctccttgcatttcttta
tctcgagaaatgcttaatatgggccggactgatgcccgcaaaacaattgcacagatcaag
gatgaaaatttgggacgattagagaagccagactggatcactgttaaggctgcaatctcc
catgtgactactgagagtttttgttatccagcttgcccaaagctcttgcccgtcgggagg
cagtgtaataaaaaggcaataaataatggtgatgggatgtggcattgtgaccgatgtgat
gagagttttcaaaatcctgaatataggtacatgcttaggttccagatccaagaccacact
ggtagtacctatgctagtgcgttcgatgaggcaggtgagcagatttttggtcgcaaggca
ggagaacttttctcgataagaaatgtcgaccaagatgatgcacaatttgcagagatcata
gaaggggtccggtggcatctatatctattcaaactgaaggtcaaggaagaaacctacaat
gatgagcaaagcttgaaatgcaccgctgtcaaggttgaaaaactggacccatcaaaagag
agcaacgtcctacttggagcgattgacaaccttttactggacccaaaggggcaaagtgat
cttgcccctaatgctggtttcaccgatccggtaggcggtcacggtgcgcctacatctagc
aatgcctatgccatgaatactggtggcgtgaatcagtttgggcagcaagcgagtataagc
gccgggatgtctactccactagcagcaacacgaaacttgcagacatgcagcatttgtgga
gcaaatgggcacagcgcccagatctgccatgtgggtgcagatatggatatgcaggaaaca
tcagccggtggaagctccatgggtaactacaactccatcgctggcaacggcagctcggag
tgttacaaatgtaaacagcccgggcactatgctagagactgtccagggcagtccactggt
ggcttggagtgtttcaaatgtaaacagcctgggcacttttctagagactgtccagtgcag
tctactggtggctcggagtgtttcaaatgtaaacagcctgggcacttcgctagagattgt
ccagggcagtctactggcgcccagcaccagacatatgggaataatgttgcagcatcaagg
ggttacaataggcaatcctttgttggtggctactga

DBGET integrated database retrieval system