KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330908
Entry
4330908           CDS       T01015                                 
Name
(RefSeq) isoleucine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4330908
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4330908
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4330908
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     4330908
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4330908
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4330908
 Prokaryotic type
   Other AARSs
    4330908
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g zf-FPG_IleRS tRNA-synt_1_2 Glyco_hydro_36
Other DBs
NCBI-GeneID: 4330908
NCBI-ProteinID: XP_015626267
UniProt: Q0DX31
LinkDB
Position
2:32932391..32945156
AA seq 1058 aa
MDAASCCRVFSTQRCRFPLRRLAPPISRRPFGTESTSELFAASTSKRRSRGPVMAAKKAA
EGAKQEEGKYKHTVDLPKTTFGLRANSVVREPELQKLWEENQVLKRVSERNTGATFVLHD
GPPYANGDLHMGHALNKILKDIINRYKLLQNHKVSFIPGWDCHGLPIELKVLKSLDKETL
NALTPIKLRQKAAKFAKATVTTQMNSFKRFGVWADWDNPYLTLSPEYEAAQLEVFGQMVM
KGYIYRGRKPVHWSPSSRTALAEAELEYSENHISKSMYAAFKITNLSKPGLLEEFLPNLC
LAIWTTTPWTIPANAAVAVNPELTYVVVELQSVLESESTSGGNQRKLGSILSPGSQKPFI
IVAADLVSALESKWGTKLIIQKSFPGSALEHCRYIHPVNGNECSVVLGGDYITTESGTGL
VHTAPGHGQEDYITGLKYGLPIVSPVDDEGNFTAEAGQFSGLSVLGAGNAAVVNYLDEQC
SLILEEPYKHKYPYDWRSKEPTIFRATEQWFASVDGFRNAAMDAIRRVSWIPSQAENRIV
AMTSSRSDWCISRQRTWGVPIPVFYHVDSNEPLITEETIEHIKGIVSKKGSDAWWYMTIE
ELLPEKYRDKASEYRKGTDTMDVWFDSGSSWAAVLAQRDGLNFPADIYLEGSDQHRGWFQ
SSLLTSIATTGKAPYSSVITHGFVLDEKGFKMSKSLGNVVDPEKVIVGGKNSKQEPGYGA
DVLRLWVSSVDYTGDVLVGPQILRQMSDMYRKLRGTMRFLLSNLHDWKPENSVRYSDLPK
IDKYALFQLENVVTSMKDSYENYQFYKIYQILQRFAIVDLSNFYLDVAKDRLYVGGRVSF
TRKSCQTVLSAHLLYLVRAIAPIMPHLAEDVWQNLPFQHTLDDGSVAEFVFNLKWPVKNE
EWLSVPKDDVDFLSVILELRSEVNKILESARTGKLIGSSLEAKVYLHAENANTVSKLKEL
VSATNDADALHRLFITSEVEILPSVSSETTSGVSYTGTFSSERTGNIWIGVTRADGEKCE
RCWNYTRDVGSFLDHPTLCARCHGVIDLPPVPAAAAVS
NT seq 3177 nt   +upstreamnt  +downstreamnt
atggacgccgcctcctgctgccgcgtcttctcgacgcagagatgccgcttcccgctgcgg
aggctggcgccgccgatttcgcggcggccgttcggcacggagtcgacgagtgagctgttc
gccgcgtcgacctcgaagcggcgctcccgggggcccgtcatggcggcgaagaaggccgcc
gagggtgctaaacaagaagaggggaaatacaaacacacggtggatctaccaaagacaact
tttggcttgagagctaattctgttgtgcgggagccggagctccagaagttgtgggaggag
aaccaggtgctcaagagggtatcagaaaggaacactggggctacatttgttctccatgat
ggtcctccttatgctaatggtgatcttcatatgggccatgcactgaataaaatcctcaaa
gatattataaaccgttacaagctgcttcagaatcacaaagtttcttttattcctggatgg
gattgccatggccttccaatcgaattaaaagttctaaagtcactggacaaggaaacattg
aatgctctgacacctataaaattaaggcagaaggctgcaaaatttgctaaagcgacggtt
actacacaaatgaattctttcaagcggtttggtgtatgggcagattgggacaacccttat
ctaactctgtcaccagagtatgaagctgctcagctagaagttttcggccaaatggttatg
aaaggatatatctaccgcgggcgaaaacctgttcattggagtccgtcatcacgtacagct
ttagcagaagctgagttggagtattcagaaaatcatatttccaaaagcatgtatgctgca
ttcaagatcaccaatctgtctaagcctgggttgctggaggaatttctccctaatttatgc
ctagccatatggaccactactccatggacgattcctgctaatgctgctgttgctgtgaac
cctgagctcacttatgtagtagttgagctgcaatctgtactagaaagtgaatcaacatct
ggtggaaatcaacgaaagcttgggagtattttgagccctgggagtcagaaaccatttatc
atcgtggctgctgatcttgtctcagctctagagtccaagtggggtacaaagcttataatc
cagaaatcatttcctgggtcagccttggagcactgcaggtatattcatcctgtgaatggc
aatgaatgttctgttgttcttggaggagattacataacaactgaatctggcactggcctt
gttcatactgcccctggccatggtcaggaagactacataacaggtttgaaatatgggctt
cctattgtgtctcctgtggatgatgaaggaaacttcactgctgaagctggacaattcagt
ggtttatctgttctgggagctggtaatgccgcggttgtgaattatctggatgaacagtgt
tctctcattttagaggagccttacaaacacaagtacccctatgactggcggtctaaagaa
ccaacaatattccgagcaactgaacaatggtttgcctcggtggatggtttccgtaatgct
gcaatggatgcaattaggcgagtatcttggattccttctcaggctgaaaataggattgtg
gccatgacttcaagccgttctgactggtgtatttcgcggcagagaacttggggggttcct
attccggtcttctatcatgtagactcgaatgaacctcttataactgaagaaactattgaa
cacatcaagggtatagtgtcaaagaaagggagtgatgcctggtggtatatgacaattgag
gaacttcttcctgaaaaatatcgtgataaagcatctgagtatcgcaagggaactgataca
atggacgtttggtttgactctggctcctcatgggctgctgttttggcacaaagagatggc
cttaattttccagcggatatataccttgaaggttcagaccaacaccgtggatggtttcag
agctcattgttaaccagcattgctactacaggaaaggctccatattctagtgttataacc
catggttttgtactggacgaaaagggtttcaagatgagcaaatctcttggtaatgtggtt
gatcctgagaaagtaattgttggtggtaaaaattcaaagcaagaacctggctatggagca
gacgttcttcggctatgggtttctagtgttgattacactggagatgtgttggttggtcca
caaattttgcgccaaatgtctgacatgtaccgaaagctacgaggcacaatgcgattccta
ttgtcgaatctccatgattggaaaccagaaaattctgtgcgctacagtgatctaccgaaa
attgacaagtatgcacttttccaactggaaaatgttgtgacttccatgaaggatagctac
gagaactaccaattctataaaatataccagatcctccaaagatttgctattgttgatctc
tccaatttctatttggatgttgcaaaggatcgactctatgttggtggccgagttagcttt
acaaggaaaagctgtcagacagtcctcagtgcgcatctgctctatcttgttagagccatt
gcccccattatgccacatctagctgaggatgtatggcagaacctaccgtttcaacacaca
ctggatgatggatctgttgctgagtttgtttttaatctaaaatggccagttaagaatgaa
gaatggctctcggttccaaaggatgatgttgattttctgagtgttatcctcgagttgaga
tcagaggtgaacaaaattttggagagtgctcgaacaggaaagctgataggctctagctta
gaggcaaaagtttatctccacgcggaaaatgctaacacagtgtccaaactaaaggagctg
gtttcggcaaccaatgacgctgatgctctgcaccgcctgtttatcacatctgaggtggag
atccttccttccgtaagctccgaaactacatctggtgtatcctacactggaacttttagc
agtgagcgcaccggcaacatctggattggtgtgactcgcgccgatggcgaaaaatgtgag
aggtgctggaattatacccgagacgttggatctttccttgaccatcctactctttgtgcc
cggtgccacggtgtcattgatctgccaccagttcctgctgccgcggctgtcagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270869
Entry
9270869           CDS       T01015                                 
Name
(RefSeq) isoleucine--tRNA ligase, cytoplasmic
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9270869
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9270869
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9270869
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     9270869
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   9270869
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    9270869
 Prokaryotic type
   Other AARSs
    9270869
SSDB
Motif
Pfam: tRNA-synt_1 DUF5915 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f
Other DBs
NCBI-GeneID: 9270869
NCBI-ProteinID: XP_015643842
LinkDB
Position
6:26332893..26345256
AA seq 1172 aa
MEDVCEGKDFSFPAEEERVLKLWSELDAFHEQLRRTKGGEEFIFYDGPPFATGLPHYGHI
LAGTIKDVVTRHQSMRGRHVSRRFGWDCHGLPVEFEIDKQLGITNRQQVFDLGIGKYNET
CRGIVTKYVAEWEAVVTRTGRWIDFKDDYKTMDINFMESVWWVFSQLWEKDLVYKGFKVM
PYSTGCKTALSNFEAALDYRTVPDPAIMVSFPIIGDADNAALVAWTTTPWTLPSNLALCV
NANLVYVKVKDKSTGAVYVVAESRLGQLPAKAKSSGKKQAPSKGGTAEVVQGGLDTEAYE
LLAKFPGSSLVGLKYKPLFDFFLELQETAFRVIADNYVTDDSGTGVVHCAPAFGEDDHRV
CLAAGIIEASGLVVAVDDDGCFIEKISEFSGRYVKEADRDIINSVKDKGRLVSKGSIEHS
YPFCWRSGTPLIYRAVPSWFVKVEKIRDQLLECNKQTYWVPDYVKEKRFHNWLEGARDWA
VSRSRFWGTPLPLWISQDGEEIVVMDSIEKLERLSGVKVNDLHRHYVDGITIPSSRGPEY
GVLKRVEDVFDCWFESGSMPYAYIHYPFENRELFEKNFPGNFVAEGLDQTRGWFYTLMVL
STALFGKPAFKNLICNGLVLAEDGKKMSKSKKNYPSPVEVIDEYGADALRLYLINSPVVR
AESLRFKRSGVFGVVKDVFLPWYNAYRFLVQNAKRLEIEGFSAFSPIDQASLLKSSNVLD
HWINSATESLVSFVHQEMDAYRLYTVVPYLVKYIDNLTNIYVRFNRKRLKGRTGEEDCRV
SLSTLYHALVTTCVAMAPFTPFFTETLYQNLRKVSTKPEDSIHFCSFPSTTGERDERVEQ
SVNRMMTIIDLARNIRERHNKALKTPLKEMVIVHPDNEFLEDITGKLKEYVMEEMNVKTV
TPCNDPMLYASLRAEPNFSVLGKRLGKDMGKVSNEVKKMTQEQILAFEQSGEISFFGHCL
KLDDIKVIRQFKRPANVAENEIDAAGDGDVLVVLDLRADQSLFEAGVAREVVNRIQKLRK
TAQLEPTDLVDVYYKPMDDGKNTLVEIVQSQDQYIRDALGNPLIPKMAAPPDAVMICEES
HNVQDMSFVIYIARVSPVVTDDLLVHAAGNREHFDALKVYLLSRSISRLKNEFQAGNGKI
TVDFIEGFPPIDLQLGKHVFLSTGDFYLATRS
NT seq 3519 nt   +upstreamnt  +downstreamnt
atggaggacgtctgcgaggggaaggacttctccttccccgcggaggaggagcgcgtgctc
aagctgtggtcggagctcgacgccttccacgagcagctccgccgcacgaagggcggcgag
gagttcatcttctacgacgggcccccgttcgccaccggcctcccgcactatggccacatc
ctcgcgggcacaatcaaggacgtggtcacccgccaccagtcgatgcgcggccgccacgtc
tcccgccgcttcgggtgggactgccatggcctccccgtcgagttcgagatcgacaagcag
ctcggcatcaccaaccggcagcaggtgttcgacctcggtatcggcaagtacaacgagacc
tgccgcggcatcgtcaccaagtatgtcgccgaatgggaggccgtcgtcacgcgcacgggg
aggtggatcgacttcaaagacgactacaaaaccatggacataaatttcatggagtccgtt
tggtgggttttctcgcagctctgggagaaagacctcgtctacaagggtttcaaggtgatg
ccttacagtacaggatgcaagactgcactatcaaactttgaggccgcacttgactatagg
actgtcccagatccagcaatcatggtgtctttccctattatcggtgatgcggacaatgca
gcacttgttgcatggactacaactccctggacacttccaagcaacttagccttgtgtgtc
aatgccaatcttgtgtatgtcaaggttaaggacaagtcaactggagcagtgtatgttgtt
gctgaatctaggcttgggcaattgccagccaaggctaaatcatctggaaagaagcaagca
ccttctaagggaggcactgctgaagttgttcagggtggattggatactgaagcatatgaa
ttattggcaaagtttccaggatcatccttagtaggcctaaaatacaaacctctgttcgat
tttttcttggagctccaagagactgcctttagggtgatagcggataactacgtaactgat
gatagtggaactggtgttgtccattgtgctcctgcttttggtgaagatgaccaccgtgtt
tgtcttgctgctggtatcattgaggccagtgggcttgttgtcgccgttgatgatgatggc
tgcttcattgaaaagatatctgagttcagtgggcgatatgtcaaagaggctgacagggat
atcatcaactctgttaaggataaaggaagacttgtcagtaaagggagcattgaacactct
tatccattttgctggcgctcgggcactcctcttatttaccgggctgtcccaagctggttt
gtgaaggttgaaaagattagggaccagttgctggaatgtaacaagcagacctattgggtt
ccagattatgttaaggaaaagcggttccataattggctagaaggtgctagggattgggct
gttagcagaagtagattctgggggactccactaccgctgtggatcagccaagatggtgaa
gaaattgttgttatggattccattgagaaacttgaacggttatctggtgtcaaggttaat
gatcttcaccgacactatgttgatggtatcacgattccctctagcagaggtccggagtat
ggggtgctcaaacgagttgaggatgtttttgactgctggtttgagagtggttccatgcca
tatgcctacattcattatccatttgagaaccgtgaattgtttgagaagaactttcctggc
aactttgtggcagagggattggatcaaacacgcggatggttctatactttgatggtgtta
tcaacagctttatttgggaaacctgcatttaaaaatctgatatgcaatggtcttgtatta
gctgaggatggtaagaaaatgagcaagagtaaaaagaattacccttcacctgtagaagtc
atcgatgaatacggagcggatgctttgagactgtatttgataaattctccagttgtacga
gcggagtctctacggttcaaaaggagtggtgtttttggtgttgtgaaagatgtcttcctg
ccgtggtataatgcgtatagatttcttgtacaaaatgccaagagacttgaaattgaggga
ttctcagcattttctccaatagatcaagcctcacttctgaagtcatcaaatgttctagat
cactggataaactctgcaactgaaagtctagtcagttttgttcaccaggagatggacgca
tatcggctttacacggttgtgccatatttggttaaatacatcgacaatcttactaatata
tatgtgcgtttcaaccgtaaacggttaaaaggacgtactggggaagaagactgcagagta
tctctttcgacgctctaccatgcacttgtaacaacttgtgtggcgatggctccatttaca
cccttctttactgaaactctctatcaaaacctacgaaaggtgtcaactaaaccagaggat
agtattcatttctgcagtttcccttccacaactggggagagagatgagcgtgttgagcaa
agtgtaaacagaatgatgaccatcattgatcttgcccgcaatattcgtgaacggcataac
aaagccttgaaaacaccactgaaggagatggtgattgttcatcctgacaatgaatttctt
gaagacataacgggaaagctaaaagagtatgtcatggaagaaatgaatgttaagactgtc
actccatgtaatgatcccatgttgtatgcttctctccgggcagaacccaattttagtgtg
ctaggaaaaagactgggaaaggacatgggcaaagtgtcaaatgaagtgaagaaaatgaca
caggaacagatcttagcctttgaacaaagtggagaaatttcattctttggtcattgcttg
aagttagacgatattaaggtgatccggcaatttaaacgtcctgcaaatgtggcagagaat
gaaattgatgctgcgggagatggtgatgtgttagtcgttttggatcttcgagctgatcaa
tcattgtttgaagctggagttgctcgagaggttgtgaacagaatccagaagttacgaaag
acagcgcaacttgagccgacagacttagttgatgtatattacaaacctatggacgatggc
aagaatactctagtagagattgtgcagtcacaggatcagtatataagggatgctcttggc
aatccactaattccaaagatggcggcgccaccagatgcagtaatgatctgtgaggagtct
cacaatgtacaagacatgtcgtttgtcatttacattgcaagggtttctccagtggtcaca
gatgatctccttgtccatgccgctggcaaccgtgagcattttgatgcattaaaagtatat
ttactgtcaaggtctatttccagattgaagaatgaattccaggctgggaatggcaagatt
acggtggatttcattgaaggcttcccaccaattgatctccagctgggaaaacatgttttt
cttagtacaggagatttctacctggctactcgttcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272464
Entry
9272464           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: isoleucine--tRNA ligase, cytoplasmic
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9272464
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9272464
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9272464
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     9272464
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   9272464
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    9272464
 Prokaryotic type
   Other AARSs
    9272464
SSDB
Motif
Pfam: tRNA-synt_1 DUF5915 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f
Other DBs
NCBI-GeneID: 9272464
NCBI-ProteinID: XP_015623186
LinkDB
Position
2:complement(4657928..4680242)
AA seq 1097 aa
MDEVCEGKDFSFPAEEERVLRLWEELDAFHEQLRRTAGGEEFVFYDGPPFATGLPHYGHL
LAGSIKDAVARHHAMRGRHVARRFGWDCHGVPVERAVDEALRIATRAQVLEMGVASYNDA
CRGVVTRYVAEWEAVVTRMGRWVDFEDGYKTMDIKFMESVWWVFAQLWDKDLVYKSFKVM
PYSTGMKTPLSNFEAGQHRQFVPAETAMVSFPVVGDVDNAALVAWTTTPWTLPSNLALCX
NAKFVYAKVKDKSNGSVYIVAETRLDQLPVTVKVTGKKPGPSKGSSGAAKNGLDTESYEL
LEKIHGSSLVGLRYTPLFDYFSELQDTAFRVVADNCVADDTGTGVVHFAPAFGEDDYRVC
LASGIVEGTDLVVAVDDDGFFKDKISEFNGLLVTDKETNKYVINAVKKKGRLVSHGSVIH
KYPYCWRSNTPLIYRAVPSWFIRVERIRDQLLECNKETYWVPDYVKEKRFHNWLEGARDW
AVSRTRFWGTPLPLWISQDGEEIIVMDSVDKLEKLSGVKISDLHRHHIDGITVPSQRGEE
FGALKRVDEVFDCWFESGSMPYAYIHYPFENRELFEKNFPGDFIAEGLDQTRGWFYTLMV
LSTALFGKPAFKNLICNGLVLAEDGKKMSKSKNNYPSPMEVIDNYGADALRLYVINSPVV
RAESLRFNKNGVHGVVKDVFLPWYNAYRFLVQNAKRLEVEGLAVFSPINQAILLRSSNVL
DHWIQSATESLVSFVRQEMDAYRLYTVVPYLVKYIDNLTNIYVRFNRKRLKGRTGEDDCR
ISLSTLYHALVTTCVVMAPFTPFFTEVLYQNLRKVSSKSEKSIHFCNFPSSTGQIDERVE
HSVNRMMTIVDLARNIRERHNRPLKTPLREMVVVHPDNDFLEDITGKLKEYVKEEMNVKM
VTACSDPLVYSSLRAEPNFSVLGKRLGKDMGKISNEVKKMTQDQILTFEESGEIFFGSHL
LTLEDIKVFREFKRPANVSEKEIDAAGDGDVLVILDLQVDQSLFEAGVVREVVNKIQKLK
KTAQLRLTDPVDVYYSSQDSSDSSLEKILQSQDQYIRDALGSPLTSKAQAQPNVEVICEE
AYNVRGMSFVIYVARKQ
NT seq 3294 nt   +upstreamnt  +downstreamnt
atggacgaggtgtgcgaggggaaggacttctccttcccggcggaggaggagcgggtcctc
cgcctctgggaggagctcgacgccttccacgagcagctccgccgcacggcgggcggcgag
gagttcgtcttctacgacgggccccccttcgccacgggcctcccgcactacggccacctc
ctcgcgggcagcatcaaggacgccgtcgcccgccaccacgccatgcgcggccgccacgtc
gcccgccgcttcggctgggactgccacggcgtccccgtcgagcgcgccgtcgacgaggcc
cttcggatcgccacccgcgcccaggtgctcgagatgggggtcgccagctacaacgacgcg
tgccgcggcgtcgtcaccaggtacgtcgccgagtgggaggccgtcgtcacgcgcatgggg
aggtgggtcgatttcgaggacgggtacaagaccatggacatcaagttcatggagagcgtg
tggtgggttttcgcgcagctgtgggacaaggaccttgtctacaagagttttaaggtgatg
ccttacagcactggcatgaaaacaccattgtcgaactttgaggcaggacagcaccgccag
tttgttccggccgaaacagccatggtgtccttccctgttgttggtgatgtggacaatgca
gctcttgttgcatggacaacaacaccctggacgctacctagcaacctagcactctgtnnc
aatgcaaaatttgtttatgccaaggttaaggacaaatcaaatgggagcgtatatattgtt
gcagaaactaggctagaccaattgccggtcacggtcaaagttactggaaagaagccaggg
ccttcaaaggggagcagtggagctgctaaaaatggactggatactgaatcgtatgaacta
ctcgaaaagattcatggatcatccttggtaggccttagatatactcctttgttcgactat
ttctcagagctgcaggacaccgcatttagagtcgtagcagataactgtgtagctgatgat
actggaactggtgttgtacattttgcccctgcttttggtgaagatgattatcgtgtctgt
cttgcttcggggatagttgagggtaccgatcttgttgttgctgttgatgatgatggtttc
ttcaaagacaagatctccgaatttaatggtctacttgtcacagacaaagaaaccaacaaa
tatgtaatcaatgctgtaaagaaaaaaggaagacttgttagtcacggaagcgttatacat
aagtatccatactgttggagatctaatacacctctcatatatcgggcagttccaagctgg
ttcatcagagttgaaaggattagagatcagttgctggaatgtaataaggagacatactgg
gtgcctgattacgttaaggaaaagagattccataactggcttgaaggggctagagactgg
gctgttagccgaactagattctggggcactcctcttcctctatggatcagtcaagacgga
gaagaaataattgttatggactctgttgataaactcgaaaagttgtctggtgtcaagatt
agtgatcttcaccgacaccatatagatggcatcacagttccctctcagagaggggaagag
tttggggcgttgaaacgcgttgatgaggtttttgattgctggtttgagagtggatccatg
ccatatgcctacattcattacccatttgagaatcgcgaactgtttgaaaagaattttccc
ggagatttcatagccgaagggttggaccaaactcgtggatggttctatactctcatggtc
ctgtccacagctttgtttgggaaacctgcatttaaaaatcttatatgcaacggtctggtc
ttggctgaggatggcaagaaaatgagcaaaagtaaaaataattacccttcacccatggaa
gtcattgataattatggagcggatgccctgaggctatatgtaataaattctcctgtcgtc
cgtgcggagtccctacgattcaacaaaaatggtgtccatggtgtggtgaaagatgtcttc
ctcccatggtataatgcttatagatttcttgttcaaaatgctaagaggcttgaagttgag
ggtcttgctgtattttcaccaatcaatcaagctattcttctgaggtcatctaatgtgcta
gatcactggatacagtccgctactgaaagtctagttagttttgttcgacaggagatggat
gcatataggctttacacggttgtcccttatttagtaaagtacattgacaaccttaccaac
atatatgtgcgtttcaatcgcaagcgtctgaaaggtcgtactggagaagatgactgcagg
atttctctttcaacactttaccatgcgcttgtaacaacttgtgttgtgatggctccgttt
actcccttcttcactgaagttctgtaccagaacttaagaaaggtgtccagcaaatcagaa
aagagcattcatttctgcaatttcccttcctcaactgggcagatagatgagcgtgttgag
cacagtgtcaacaggatgatgaccatcgttgatcttgctcgaaatattcgggagcggcat
aacagacctttgaaaacaccattaagggagatggtagttgtgcatcctgacaatgatttt
cttgaagacataactggaaagctgaaagagtatgtcaaggaggagatgaatgtcaagatg
gtcactgcttgtagcgatcccttagtgtattcatctttacgtgctgaacctaacttcagt
gtgttaggcaaaagattaggaaaagacatgggcaaaatatcaaatgaggtgaagaagatg
actcaggatcagatcctaacatttgaggaaagtggcgaaatattttttggcagtcatctc
ttgacgttggaagatattaaggtttttcgagaattcaagcgccccgcaaatgtgtcagag
aaggaaattgatgctgcaggagatggcgatgttttggttatcttggatctccaagttgat
caatcattgtttgaagctggagttgttcgtgaggttgtgaacaaaattcagaagttgaaa
aagactgctcagctgagactgaccgacccagttgatgtttactacagttcacaggatagc
agtgatagctctctcgaaaagattttgcaatcgcaggatcaatatattagagatgcactt
ggttcccctcttacctcgaaggcacaggcacaacccaatgtggaagtaatctgtgaggag
gcctacaacgtacgtggcatgtctttcgttatctacgtggcaaggaaacagtga

DBGET integrated database retrieval system