KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330923
Entry
4330923           CDS       T01015                                 
Name
(RefSeq) ATP-dependent DNA helicase Q-like 3
  KO
K10901  bloom syndrome protein [EC:5.6.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4330923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4330923
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330923
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     4330923
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4330923
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     4330923
    Bloom's syndrome complex (BTR)
     4330923
   FA (Fanconi anemia) pathway
     4330923
SSDB
Motif
Pfam: DEAD Helicase_C RecQ_Zn_bind ResIII
Other DBs
NCBI-GeneID: 4330923
NCBI-ProteinID: XP_015622950
LinkDB
Position
2:complement(33084410..33093866)
AA seq 753 aa
MKRQLPIKGASGASGSGHGKKAPQELENVLKQHFGYSGFRGKQLEAIEAVLSGRDCFCLM
PTGGGKSMCYQIPALVKSGIVLVISPLIALMENQVASLKSKGIPAEFLSSTQTSHNKQKI
HEDLDSGNPSLKLLYVTPELVATSGFKAKLTKLYNRGLLGLVAIDEAHCISTWGHDFRPS
YRKLSSLRNQFPDIPILALTATAVPKVQKDVISSLCLRNPLILRASFNRPNIFYEVRYKD
LLDDVYSDISNLLKSSGNVCSIVYCLERAVCDDLTMHLSQQGISSAAYHAGLNSKVRSSV
LDDWLSSRTQVVVATVAFGMGIDRQDVRIVCHYNLPKSMEAFYQESGRAGRDQQPSKSVL
YYGLDDRKKMEFILRNTKNKKSELSSSSTELSEKALADFSQIIDYCENSTCRRKMIIESF
GEKVQPTLCQRSCDACKHPNLVSSRLEELRRVPTCRYNKISPVFKSSLANPKHMETEFWN
REDDASISVEDISDSDDGKEVVSNTAISKLPSKAGLDAKFEALERAENAYYQAKGQTKQQ
GGKLVDKKSISQTLRDASQKRLLNGLGQAKLRLGNLPFDEEPSAAHLEVECFKKYEKVGK
TFYNSQIAATVRWLSSSSLDQIQDRLHALADQITDHGAAASSPSIVPESPPASPDVICKI
PGEATSNEAKDIPLKNNTEEFVTTEHSDEIAKVAVLSENMELPKIPSFREFMSQKGRDRA
TSSSKVESLPSGVRRKVGIEKQGTTGPSKKMKS
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgaagagacaacttcccataaaaggtgcatcgggggcctcgggatctgggcatggaaag
aaagctcctcaggagctggagaacgtcttgaagcaacatttcggatattcaggctttcga
ggaaagcaactagaggctatagaagctgttctttcaggaagggattgcttttgtttgatg
ccaactggaggtggaaaatcaatgtgctatcagattcctgctctagtgaagtcaggcatt
gttcttgttatctcacccttgatagcactaatggagaatcaggttgccagcttgaaaagc
aaaggtattccagctgagtttctctcgtcaacacaaacatcgcacaataaacaaaagata
catgaagaccttgattctggtaatccttctctaaaattgctatatgttactcctgagttg
gttgcaacatctgggttcaaggcaaagctaacaaagctctacaatagaggtctccttggt
cttgttgctattgatgaggctcattgcatttcaacttggggccatgatttcagacctagt
taccgcaagctttcatcactgaggaaccagttcccagacatacctatattagctttaact
gcaaccgcagttccaaaagtccagaaagatgtgatatcgtcactgtgcttgagaaatcca
ttaattcttagggcatcatttaatcggcctaatatattctatgaagttcgctacaaggat
ctccttgatgacgtttattctgacatatcaaatttactgaagtccagtggaaatgtttgc
tcaattgtgtactgtcttgaacgtgcggtttgtgatgatctaactatgcatttgtcacag
cagggtatctcctctgctgcttatcatgctggcctaaatagcaaggtgcggagttctgtt
cttgatgattggctttcctcgagaactcaagttgttgttgccactgttgcatttggaatg
ggtattgatagacaagatgtccgtattgtgtgtcactataacttgcctaagtccatggaa
gccttctaccaggagtcaggacgagctggccgtgaccaacagccttccaaaagtgttcta
tattatggattagatgaccgaaagaaaatggaatttattttgagaaacaccaagaacaaa
aagtcagagttatcgtcctcttcaactgaactttcagagaaggccttagccgactttagt
cagataattgattactgcgaaaattctacctgccgacgaaaaatgatcattgagagcttt
ggggagaaggtacaaccaactttatgccaacgctcatgtgatgcttgcaaacacccaaat
ctagtgtcctcacgtttggaggaacttcgtcgtgtgcccacctgtcgctataacaagata
tccccagtcttcaaaagctcgttggctaatccaaaacacatggagacagaattttggaat
cgtgaagatgatgcaagcatatcagttgaagatatatctgattccgatgatgggaaggag
gtggtgagcaatactgccatttcaaagctcccatcaaaagcagggctagatgcaaaattt
gaagcattggagcgtgctgaaaatgcttattatcaagctaaaggtcagaccaagcagcag
ggtgggaagcttgttgacaagaagagcatatctcagacactaagagatgcaagccaaaag
cgattgttgaatggccttggacaagcaaagttgcgacttgggaatctaccgtttgatgaa
gagccttctgcagcacaccttgaggtagagtgcttcaagaagtacgagaaagtgggcaag
acgttctacaactcgcagatagccgccacagttcggtggctttcgtcttcgagcctcgac
cagatacaggaccgcctccacgcccttgctgaccaaatcacagatcatggtgctgcggca
agctccccttccatcgtcccagagtctcctccagcatctcctgatgtaatctgtaaaatc
cctggagaagctactagcaacgaagctaaggacatacctctgaagaacaacacggaggag
tttgtaacgacggagcattctgacgagattgcaaaggtggcggttttatctgaaaatatg
gagctccccaagataccatcattcagagaattcatgagccaaaaaggaagggatcgtgca
acgagttcttccaaagtagagagcctgccttccggtgttcgtagaaaggttggcattgag
aagcaagggacgacgggaccatccaagaagatgaaatcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335888
Entry
4335888           CDS       T01015                                 
Name
(RefSeq) ATP-dependent DNA helicase Q-like 4A isoform X1
  KO
K10901  bloom syndrome protein [EC:5.6.2.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4335888
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4335888
   03400 DNA repair and recombination proteins [BR:osa03400]
    4335888
Enzymes [BR:osa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     4335888
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    4335888
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     4335888
    Bloom's syndrome complex (BTR)
     4335888
   FA (Fanconi anemia) pathway
     4335888
SSDB
Motif
Pfam: RQC DEAD Helicase_C RecQ_Zn_bind HRDC ResIII HHH
Other DBs
NCBI-GeneID: 4335888
NCBI-ProteinID: XP_015633861
LinkDB
Position
4:complement(21547034..21558351)
AA seq 1174 aa
MIKPRVNWSDHANAVQSSCIKDEFLSSSFLFSLPTQRPNQEADCTGMLPLRSAACRIQGL
ERLQAPSIEKAWRSLRNTQVARKNYLRPGLSGKVKDCDSDHAHTYGTSSSYNVNKMDSVS
RNRNPTQESMHQTTESGTMEKNSSHLPAGTKSCTRTYLNNHVVQADTITTTNQSLARTGP
ELFKTAPFIDNMCDDAKLDAMDEDELLASIDVDRIVMEHYQATNTPRGSSKSPLEKCNFN
GFDENNLPQELSIMCDHGSKLAFCPEAKSHLLEMKDNLLAISHELIDGQLSPQQSDDLHQ
KRALLKKQIELLGEYTARLTQDEERQQSHSMASTTAHQGHHPTSILSSSFVKDTNIFQSP
IYTRNEPGESGLCFSSAPYSYMDGLSMPLPSVQRDYTPRAIDISYTEGSGDKQWSSTHFA
WTKELEANNKRVFGNRSFRPNQREIINATMSGNDVFVLMPTGGGKSLTYQLPALICNGVT
LVVSPLVSLIQDQIMHLLQANISAAYLSASMEWSEQQEILRELMSPTCTYKLLYVTPEKI
AKSDALLRQLENLYSRGHLSRIVIDEAHCVSQWGHDFRPDYQHLGILKQKFPQTPVLALT
ATATASVKEDVVQVLGLANCIIFRQSFNRPNLRYFVWPKTKKCLEDIHNFIHANHNKECG
IIYCLSRMDCEKVAAKLREYGHTASHYHGSMDPEDRANIQKQWSKDRINIICATVAFGMG
INKPDVRFVIHHSLPKSIEGYHQECGRAGRDSQLSTCVLFYNYSDYIRLKHMVTQGFAEQ
GTSAPRGGSSQEQALETHKENLLRMVSYCENDVDCRRLLQLIHFGEMFNPSCCAKTCDNC
LKELRWVEKDVTNIARQLVDLVMMTKQTYSTTHILEVYRGSVNQNVKKHRHDTLSLHGAG
KHLAKGEAARILRHLVIEEILIEDVKKSENYGSVSSVLKTNHKKSGDLLSGKHNVVLKFP
TPEKAPKMGVLDESSVPRINKTNQQSQVDGSLAAELYEALQCLRTQIMDENPQLLAYHIF
KNETLKEISNRMPRTKEELVEINGIGKNKLNKYGDRVLATIEDFLARYPNATRKTSSGGS
NEHSEAVKKRRGFSVTNTSTNCDDFEERTVQSKKRAAKTRTRQEISDAASIVQDVRYIDL
ELDGCEQVNEVPYSVQKPVASGRVLPAWQSARIA
NT seq 3525 nt   +upstreamnt  +downstreamnt
atgataaagccaagggtcaactggtcggatcatgcaaatgctgttcaaagctcctgtatc
aaagatgaattcctgagttcaagttttttgttctctttaccaacacaaaggcctaatcag
gaagcagattgtacgggaatgcttcctttaaggtctgctgcttgcagaattcaaggccta
gagcgtcttcaagctccatccattgagaaggcctggcgttctctacgcaacactcaggtt
gcacggaagaattatttaagacctggtttatctggaaaagtgaaagattgtgatagcgac
catgctcatacttatgggacaagttcttcatataatgttaacaaaatggacagtgtgtcc
agaaataggaatcccacccaggaaagtatgcatcagacgactgaaagtggtactatggag
aagaacagtagccatctgcctgcaggcaccaagtcctgtacaaggacttacctgaacaat
catgtggtgcaggcagataccattacaacaacaaatcaaagtcttgcaagaactggtcct
gaattattcaagactgctccttttattgacaacatgtgtgatgatgctaaattagatgcc
atggatgaggatgagcttctagcgagtattgatgtggaccgaatagtcatggaacattat
caagcaacaaatacacccagagggtcatccaaatctccattagagaagtgcaacttcaat
ggatttgatgagaataatttaccacaagaactctctataatgtgtgaccacggtagcaag
ctagctttttgcccagaggcgaagtctcatttgcttgaaatgaaggataacttgcttgca
atatcccatgagcttattgacggtcaactcagccctcaacaatctgatgatcttcatcaa
aagagagcactcctaaagaagcagattgagctgcttggggagtatacggcgaggttaacc
caagatgaagagcgacagcaatctcattctatggcctccacaacagctcatcagggccat
caccccactagcatcctaagtagctcttttgtaaaggataccaatatattccaatcaccg
atttacaccaggaatgaacctggggaaagtggtttatgcttttcttctgctccatattcc
tatatggatggtttaagcatgccattaccgtctgttcagagagattacactccaagggct
attgatatcagttacactgaaggttctggtgataaacagtggagtagtacacactttgca
tggactaaggaactcgaggccaacaacaaaagagtatttggaaaccgttcttttcgccca
aatcaacgagaaataatcaacgccacaatgagtgggaatgatgtttttgttttgatgcca
actggtggtggaaaaagtttgacatatcagcttccagcactcatttgtaatggcgttaca
ttggtagtttctcctctcgtatcgctcatccaagaccagatcatgcatttattgcaggca
aatatttctgcagcttaccttagcgccagcatggagtggtcagaacagcaggagatatta
agagaattaatgtctcctacatgcacgtacaagttactgtatgttacgcctgaaaagata
gccaagagtgatgctctgttgagacaattggaaaatttatattcgcgaggccatctctct
agaattgtcattgatgaagcccactgtgttagccagtggggtcatgatttccgacctgat
taccagcatctaggcattttaaaacagaagttcccgcagacgccagtcctggccttgact
gcaacagcaactgcaagtgtcaaggaagatgtcgtgcaagttctaggccttgcaaactgc
attattttcagacaaagttttaatcgtccaaatctgaggtattttgtatggcccaagaca
aagaagtgcctcgaggatatccataactttatacatgcaaatcataataaagaatgcggc
atcatatattgcctttcgaggatggattgtgagaaagtggctgctaaattaagggaatat
gggcacacggcatcacattatcatggtagcatggatcctgaggatagagcaaatatccag
aaacagtggagcaaggataggatcaacataatatgtgctacagttgcatttgggatgggt
attaataaacctgatgtccgttttgttatccatcattccctgcccaaatcaattgaagga
tatcatcaggagtgtggacgtgctggtcgtgacagtcagctttcaacttgtgtcctgttc
tacaattattctgattatattcgtctcaaacacatggttacccaaggatttgcggagcaa
ggaacatcagcaccacgaggaggttcttcgcaggaacaagcgcttgaaacgcataaggaa
aatctcctgcgaatggttagttactgcgaaaatgatgtggactgcagacgtctactacag
ctgatccactttggagagatgtttaatccttcatgttgtgcaaaaacatgtgataattgc
ttgaaagagttgagatgggtcgaaaaagatgtgaccaacattgctagacaattggttgat
ctggtaatgatgacaaagcaaacatattcaactactcatattctcgaagtatacagaggt
tcagtaaaccaaaatgtcaagaagcaccgccatgatactttgagtcttcatggagctgga
aagcatctagctaaaggtgaagcagcgagaatattgcgccatctagtaattgaggaaata
ctcattgaggatgtcaaaaagagcgaaaactatggatctgtatcatctgtcttaaagact
aatcataagaaaagtggtgatcttctctctggcaagcacaacgttgtcctcaagttcccc
actcctgagaaggctcctaagatgggtgtactcgatgaatcgtcagttccacgaattaat
aagactaatcaacagagtcaagtggacgggagccttgcagccgagctttatgaagctttg
caatgccttaggactcagataatggatgaaaatccacaattattggcataccacatattt
aaaaacgagacattgaaggaaatcagcaaccgaatgccaagaacgaaagaggaacttgtg
gagataaatggcatcggcaagaacaagctgaacaagtacggggaccgtgtgcttgcaacc
atagaggatttcctcgccagatatccaaatgcgaccaggaaaaccagcagcggcggcagc
aacgagcacagcgaggcggtcaagaagcgaagaggcttctccgtcaccaacacctctacc
aactgtgacgactttgaggaacgcacggtccagtccaagaaacgcgctgcaaagacacgt
acaaggcaggaaatatctgatgctgccagcatcgtccaggacgtccgctacatagatctt
gagctagatggttgtgaacaagtcaatgaagtgccatacagtgtacaaaagcctgtggct
tctggtagggttttacctgcgtggcagtccgccagaatagcctag

DBGET integrated database retrieval system