KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330931
Entry
4330931           CDS       T01015                                 
Name
(RefSeq) probable NOT transcription complex subunit VIP2
  KO
K12605  CCR4-NOT transcription complex subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4330931
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4330931
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4330931
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4330931
SSDB
Motif
Pfam: NOT2_3_5
Other DBs
NCBI-GeneID: 4330931
NCBI-ProteinID: XP_015627123
UniProt: Q0DX09
LinkDB
Position
2:complement(33159682..33169020)
AA seq 622 aa
MSGLLNSNLNNSASNLQDSTGRPFTGSFSGQSGSVPGGFHHSGLHNMHGSLNMPNMPGSF
SQRNAAMSGLPSSGVQQPGGSMPGRFASNNLPVGMSQIPHGHSGVGSRGLNVGGGPAFSS
SLNIGGTIQGLSSNLGAGGSRNSVPGMSVSPSLGNLGPRITGSVGNIVGGSNIGRNISSG
GLSVPSIASRMNLSGNVGSGGLNVQGSSRMMNGILQQGSPQMLNMMGSLYPTSGGSLSQN
QIQGGNNSLGSMGMLHDASDGAPFDMSDFPQLTGRPSSAGGPQGQYGSLRKQGVGVNTIV
QQNQEFSIQNEDFPALPGYKGNTTDYAMELHHKEQLHDNVPVMQAQQYPMSRSVGFNLGS
NYPPNRQQHQQGANSVQNAGPPNIGLRPLNSPNQTSSLGSYEQLIQQYQQPQAQNPFRLQ
QVSSATQSYRDQSLKSIQGGQTPSDPYGLMGLLGVIRMNDVDLSSLALGIDLTTLGLNLN
SPDNLYKTFGSPWSNEPAKGEPEFHTPACYSAEQPPPLQPIHFQKFQTPTLFYIFYSMPR
DEAQLCAASELYTRGWFYHKEVRVWLTRIPNVEPLVKTPHYERGSYGCFDPNNWETIRKD
NFVLHYDQIEKKPAIPSSQNVR
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgtcgggcctgctgaattcaaacctgaacaattctgcatcaaatcttcaagactcaact
ggaagaccgtttacagggtccttttctggtcaatctggatcagttccagggggtttccat
cactctggtttgcacaacatgcatggaagtttaaatatgccaaatatgcctggatcgttt
tctcagaggaatgctgccatgagtggccttccatcctctggggttcaacagcctggaggg
agcatgcctgggagatttgcttcaaacaaccttccagttggcatgtcccagatccctcat
ggtcattcaggagtcggtagtagaggattgaatgttggtggaggtccagcatttagtagt
agcctgaatattggtggtaccattcaaggcttatcctcaaacctgggtgctggtggtagt
cgtaattctgttcctgggatgtcagtatctccatctttgggaaatttgggtcctaggatc
actggttctgtaggaaatattgtgggtggaagtaacattggaaggaatataagctctggt
ggattatctgtgccaagcatagcatcacgcatgaatttgagtggcaatgttggcagtggc
ggtctgaatgtccaaggatccagcaggatgatgaatggcattcttcagcaaggatcacct
caaatgctgaacatgatggggagtttatatccaacatctggaggttctttatctcagaac
caaatacaaggaggaaataattcccttggttctatggggatgctgcatgatgccagtgac
ggtgctccatttgacatgagtgattttccccagctgactggtcgacctagttctgcgggt
ggtccacaaggacaatatggctccctacggaagcaaggagttggtgttaacaccattgtt
cagcaaaaccaggaattcagcattcaaaatgaagacttcccggctttacctggatacaaa
ggcaacactacagattatgctatggagttgcatcacaaggaacaacttcatgataatgta
cctgttatgcaagcgcaacaatatccgatgtcaagatcagttggctttaacttaggaagt
aactacccaccaaatcgtcagcaacaccagcaaggtgctaattcagttcagaatgctggt
cccccaaatatcggactaagaccactaaattctccaaatcaaacttctagtttgggatca
tatgagcaacttatccagcaataccagcaacctcaggctcaaaatcctttcagattgcag
caggtgtcttcagctacccagtcatatagggatcagagtctaaagtccatccaggggggc
caaacaccatctgatccatatggcttgatgggattgctaggagttatcaggatgaatgat
gttgacttatcatctcttgctttaggaatagatttgacaacattgggtttaaacttgaac
tcaccagacaatctgtacaagacatttggctctccatggtcaaacgagccagcaaaagga
gaacctgagtttcatactccagcttgctactccgctgagcaacctccaccactacaacct
atacattttcagaaattccagacgccaacactgttttacatcttctatagcatgccaagg
gatgaagctcagctatgtgctgctagtgagctgtatactcgaggatggttctaccataaa
gaagtgcgtgtgtggctcaccagaattccaaatgttgagcctctggtcaaaacacctcat
tatgaacgaggatcttatggttgctttgatccaaacaactgggagacaatccgcaaggac
aactttgttctccattatgatcaaatagagaagaagccagctatcccttcatcccaaaac
gttaggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334027
Entry
4334027           CDS       T01015                                 
Name
(RefSeq) probable NOT transcription complex subunit VIP2 isoform X1
  KO
K12605  CCR4-NOT transcription complex subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4334027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4334027
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4334027
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4334027
SSDB
Motif
Pfam: NOT2_3_5
Other DBs
NCBI-GeneID: 4334027
NCBI-ProteinID: XP_015630450
LinkDB
Position
3:complement(30157012..30173946)
AA seq 625 aa
MSGLLNSNLNNSASNLQDSSGRPFTASFSGQSGSVPGAFHHSGLHNIHANFNLPNMPGSL
AQRNAAMSGLPSSGVQQPGGSISARFASNNLPVGMSQLPHGHSGVSSRVNVGGGPAFSSS
LNIGGTIQGLSSNLGAGGNRNSVPGMSVSPALGNLGPRITGSVGNIVGGSNIGRNISSGG
LSVPSIASRMNLSGNIGSGGLNVQGSSRMMNGILQQGSPQMMNMMGSSYPTSGGSLSQNQ
IQGGNNSLGSMGMLHDANDSAPYDMNDFPQLTGRPSSAGGPQGQYAGSLRKQGVGVNTIV
QQNQEFSIQNEDFPALPGYKGSTSDYAMELHHKEQLHDNVPVMQAQQYPMSRSVGFNLGS
NYPPNRQQHQQGANSVQNAGPQNIGLRSSASQTSSLGSYEQLIQQYQQPQTQNPFRLQQV
SSATQSYRDQSLKSIQGGQTPPDPYGLMGLLGVIRMNDADLASLALGMDLTTLGLNLNSP
DNLYKTFGSPWSNEPAKGEPEFHIPACYNAEQPPPLQPIHFQKFQTLTLFYIFYSMPRDE
AQLCAASELYNRGWFYHKEVRVWLTRIPNVEPLVKTPHYERGSYGCFDPNNWETIRKDNF
VLHYDQIEKKPAIPSSSQTVRGNIS
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgtcaggcctactgaattcaaacctgaacaattctgcatcaaaccttcaagactcatct
ggaagaccgtttacagcatccttttctggtcaatctggatcagttccaggggcgttccat
cactctggcttgcacaacatccatgcaaattttaatctgccaaatatgcctggatcgctt
gctcagaggaatgctgccatgagtggccttccatcctctggggttcaacagcctggaggg
agcatttctgcaagatttgcttcaaacaaccttccagttggaatgtctcagcttcctcat
gggcattcaggagtcagttctagagtgaatgttggcggaggtccagcatttagtagtagc
ttgaatattggaggtaccattcaaggcttatcctcaaacttgggtgctggtggtaatcgg
aattctgttcctgggatgtcagtatctccagctttgggaaatttgggccctaggatcact
ggttctgtaggaaatattgtgggtggaagtaacattggaaggaatataagctctggtgga
ttatctgtgccaagcatagcatcacgcatgaatttgagtggcaatattggcagtggcggt
ctaaatgtccaaggatccagcaggatgatgaatggcattcttcagcaaggatcgcctcaa
atgatgaacatgatggggagttcatatccgacgtctggaggttcattatctcagaaccaa
atacaaggaggaaataattcccttggttccatggggatgctgcatgatgccaatgacagt
gctccatatgacatgaatgattttccccaattgactggtcgacctagttctgctggtggt
ccgcaaggacaatatgcaggctcactgcggaagcaaggagttggtgttaacaccattgtt
caacaaaaccaggaatttagcattcaaaatgaagacttcccagctttacctggatacaaa
ggtagcacttcagattatgctatggagttgcatcacaaggaacaacttcatgataatgtg
cctgttatgcaagcacagcaatatccgatgtcaaggtcagttggctttaatttaggaagt
aactacccaccaaatcgtcagcaacaccagcaaggtgctaattcagttcagaatgctggt
ccccaaaatatcggattaagatcttctgcaagtcaaacttctagtttgggatcatacgag
caacttatccaacaataccagcagcctcaaactcaaaatcctttcagattgcagcaggtg
tcttcagctacacagtcatacagagatcaaagtctaaagtccatccagggagggcaaaca
ccacctgatccttatggtttgatgggattgctgggagttatcaggatgaatgatgctgac
ttagcatctcttgctttaggaatggatttgacaacattgggtttaaacttgaactcacca
gacaatctatacaagacatttggttctccatggtcaaatgagccagcaaaaggagaacct
gagtttcatattccagcttgctacaatgctgagcaacctccaccgctacaacctatacat
tttcagaagttccagacgttaacgctgttttacatcttctatagcatgccaagggatgaa
gctcagctatgtgctgctagtgagctttacaaccgaggatggttttatcataaagaagtg
cgagtgtggctcacaagaattccaaatgttgagcctctggtcaaaactcctcattatgaa
cgagggtcttacggttgctttgatccaaacaactgggagacaatccgcaaggacaatttt
gttcttcattatgaccaaatagagaagaagccagctatcccatcttcgtcccaaactgtt
aggggaaacatttcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339144
Entry
4339144           CDS       T01015                                 
Name
(RefSeq) probable NOT transcription complex subunit VIP2 isoform X1
  KO
K12605  CCR4-NOT transcription complex subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4339144
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4339144
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4339144
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4339144
SSDB
Motif
Pfam: NOT2_3_5
Other DBs
NCBI-GeneID: 4339144
NCBI-ProteinID: XP_015638214
LinkDB
Position
5:23911812..23922394
AA seq 659 aa
MRFCSIKGVEPLCLAAILGLFTSQPSHQSKRSRMGGRKSPSKSTQSSSSGARSNLPVSTG
KPLTPTFSGQSGSVSGFRHPGSLAPRGSSMTGSSSLGVQPPRGSISGAWFPPNSLQASIY
QVGYPALSNRGGMHVGGSPVFTAAPVCGNFGPRITYVASVAGGGNIGRTISSAGMSMPTV
ASPVNLSGSGALNIRGSNQMGGTHQQGLPAMNMLGSSSSAPGGTLSKNQLQAGSSSSGSP
GMRHDGNFGENSLFDINDFPQLVGRPNSAGNIQGLYGPLRQQAFGINAVQQNQEFRIHNE
DFPALPRLEGMELHRKDHLPKNANIMQAQHYPMGKSSGFNTGSSCPPRKQHKQTANSVQN
TGPENVGPKPVNSPRLPLNPRPREQVIQQNHEPQAQKSVRLQSSSGPESHKVQSPKSSQR
TDTTPESYKVQSPKPSQRTDTAPESHKVQSPKSSQRTDTAPDPYDPYGLHGLLRVMKLKE
EGPASLALGIDLTTLGLDMNSSDNLYKTFGSPWSSEPVKEEYSYEIPDCYSSMQPPPLQA
LHFLRFHLMTLFYIFYSMPQDAAQLYAANEICKYGWVYHKELRQWVKRAPNTTPLVKTTT
YEQGLCYLFDANIWDAIPKDNFILRYDDIEKIPALPPLLPATQNPATQNGSVRINKPLQ
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgcggttttgttccataaaaggggttgaacccctatgcctagccgcaattcttggtctt
ttcacctctcaaccttctcaccaaagtaaacgctcaaggatgggcggccgcaaatctcca
tcaaagtcgacacagtcaagcagtagtggtgccagatcaaaccttccagtctcaacagga
aagccgttgacaccgaccttttctggtcaatctggatcagtttcaggttttcgtcatcct
ggttcactagcaccaaggggttcctcaatgactggtagttcatcccttggggttcaacca
cctaggggtagtatttctggtgcttggtttcctccaaatagtcttcaagcatccatttat
caggtcgggtatcctgctctcagcaaccgaggaggtatgcatgttgggggaagtcctgtt
tttactgctgctccagtttgtgggaattttggcccgcgaataacttatgtggctagcgtt
gcgggtgggggcaacattgggagaaccataagctctgccggaatgtctatgcctactgtt
gcatcccctgtgaatttgtctggaagtggggctcttaatatccgaggatcaaaccaaatg
ggtggtactcatcaacaaggattgccggctatgaatatgcttggaagctctagttcagca
cctggaggaacactatctaagaaccaattgcaggcaggaagcagttcgtctggttctcca
ggaatgcgacatgatggtaactttggtgaaaattctctatttgacatcaatgattttcct
caattagttgggcgacctaattctgctggaaatattcaggggttatatggacctctaaga
caacaagcatttggtattaatgctgttcagcaaaaccaggaatttagaatccataatgag
gacttcccagctttaccaagattggaaggtatggagttgcatcgcaaggatcatcttcct
aagaatgcaaatattatgcaagcacaacattatcctatgggcaaatcatctggctttaac
acgggcagcagttgtccaccccgtaaacaacataagcagacagctaattcggttcaaaat
actgggcctgaaaatgttggaccaaagccagtaaattctccaaggttgcctttaaatccg
aggcctcgtgaacaagttatccagcaaaatcatgaaccacaggctcagaagtcagttagg
ctgcagtcatcttccggcccagagtctcacaaggttcagagtcccaagtcttctcagaga
actgataccacaccagagtcttacaaggttcagagtcccaagccttctcagagaaccgat
accgcaccagagtctcacaaggttcagagtcccaagtcttctcagagaactgataccgca
ccggatccatatgatccatatggcttacatggactactgagggtaatgaagttgaaagag
gagggaccggcatctcttgctttagggattgatttgacaacactagggttggatatgaac
tcttcagataatctttacaagacatttggctctccttggtcaagtgagccagttaaagaa
gagtattcttatgaaattccggattgctactcttctatgcagcctccacccctgcaagcg
ttgcattttctgaggtttcacctcatgacactattctacatcttctacagtatgccacag
gatgcagctcagttatatgccgcgaatgaaatatgcaaatacgggtgggtttaccacaaa
gagctgcgtcagtgggttaaaagagctcctaatacgacccctctcgtcaaaactacaact
tatgaacaaggactctgctatctttttgatgccaacatttgggatgcaattcctaaggac
aactttattctccgttatgacgatatcgagaagatacctgcccttcctccccttcttcct
gccacccaaaatcctgccacccaaaatggtagtgtaagaataaacaagccattgcagtag

DBGET integrated database retrieval system