KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330934
Entry
4330934           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phosphatase SAC3 isoform X1
  KO
K22913  phosphatidylinositol 3,5-bisphosphate 5-phosphatase [EC:3.1.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4330934
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     4330934
SSDB
Motif
Pfam: Syja_N
Other DBs
NCBI-GeneID: 4330934
NCBI-ProteinID: XP_015626560
LinkDB
Position
2:33190489..33198500
AA seq 802 aa
MAAAVAVEQEAACLQSFELYESKSRFYIFGTNTGKTHWRLLKINRSEPSDLDLHECCTVY
TQSEYHELLKNLDEDHRLTGGVKFVTKFYGIIGFIKFVGPFYMLIITEQRKIGEIFDHPV
YQVIKTSMVELANSKTRSRFLNSKDENRYKKILNTLDLRKDFFFSYSYHIMRSLQKNLSD
PQEGWNIYESTFVWNEFLTQGIRNFLGSTLWTVALVYGFFKQDKISISGKDIMFTLIARR
SRHFAGTRYLKRGVNEKGRVANDVETEQIVYGAGPRPTEVSSVVQNRGSIPLFWSQETSK
MNIKPDIILHQKGENYEATRLHFENLRRRYGDPIIILNLIKKRERRESILRREFDRAIRI
INKNIPEENHLRFLHWDLHENSRGKPTNVLDVLLKVAFRALRLTEFFYCQLAPSTGSDTA
HHWPSLLSGLDPFLCEENSNSDNTDCTEIVGDISQEDISGSSDSSCNGTTEDKAENNESP
PLKPPKFQKGVLRTNCIDCLDRTNVAQYAYGLAALGHQLHVLGSVESPELGLDDPLAHHL
MHFYERMGDTLAVQYSGSAAHNKIFSAKRGHLKLFIRSQEFFRTLQRHYSNTCIDANKQA
AINLFLGYFQPQEGKPALWELESSSVDHIAVHARTIKRVRSDGSILYGSNTSISGCSGCH
NEDKELLNAAPLDVKSGSQFPVLESDSVHGNEISLTCESEVSNLRYTPMIPQTHHVPGGV
ETESSIHSGDSNFLDLEWLSTSGNSSDERSIAISTPDVNLSAENVISGINSETMENQDAD
IYTQNLPEHFVQWVNHGDTFWY
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggctgctgcggtggcggtggagcaggaggccgcctgcctgcagagcttcgagctctac
gagagcaagtcgaggttttatatttttggaactaacactggcaaaacacattggagatta
ctgaagattaatagatcggagccatcggaccttgacttacatgagtgttgtactgtgtat
actcaaagtgaatatcatgaactgttaaaaaatcttgatgaagaccacaggttgactggt
ggtgtaaagtttgttacaaaattttatggcataatcggtttcataaagtttgttggacca
ttttacatgttaattattaccgagcagcgaaaaattggggagatatttgatcatccagta
taccaggtgattaagacttcgatggtcgagttagcgaattctaagacgcgatccagattt
ctaaattccaaggatgagaacaggtacaagaagatactgaatacacttgatcttagaaag
gacttctttttcagttactcataccatatcatgagaagccttcaaaagaacttgagtgat
ccacaggaaggctggaacatatatgagtcaacttttgtgtggaatgaatttctcacacaa
gggatacgtaattttcttggaagtactttgtggaccgttgcgttggtctatggatttttt
aagcaggataaaatttcaatatccgggaaggacatcatgttcacgctcattgctagacgc
tcaaggcattttgctggaaccagatatttaaagaggggggtgaatgagaaaggcagagta
gcaaatgatgttgagactgagcaaattgtttatggagctggacctaggcctacagaagta
agttctgttgtgcagaacaggggttcaatcccgctattttggtcacaggagacatcaaag
atgaacattaaacctgatattatattgcatcagaagggcgagaattatgaagctactagg
ctgcattttgagaatcttaggagaagatatggagatcctatcattattttaaacttgatt
aagaaacgtgagaggcgagagtcaatacttcgtcgtgaatttgatagggcgataaggata
ataaacaagaacataccagaggaaaatcatttgaggttcttgcattgggatcttcatgaa
aactctcgaggaaaacctacaaatgtgcttgatgttcttttgaaagtggcgttccgtgct
ctgaggttgactgagttcttctattgtcaacttgcaccatctaccggatctgatactgct
catcattggccttccctattgagtggtcttgatccatttttatgtgaagaaaacagcaat
agcgacaacacagactgtacggaaattgttggtgacatatcccaagaagacatctctggc
agctctgattcctcttgcaatggaactacagaggataaagctgaaaacaacgaatcacct
ccactaaaaccaccaaaattccaaaagggtgtcttacggacgaactgtatagactgcttg
gatcgaacaaatgttgcccagtatgcctatggtttagctgctcttggacatcagttgcat
gtgcttggttctgtagaatccccagaacttggtttagatgaccccttggctcatcatttg
atgcacttttatgagaggatgggtgacacccttgcggtgcaatacagtggttcggctgct
cataacaagatattctctgcaaagagaggtcatctgaagctttttattcgatcacaagag
ttcttcagaacactacaacggcactacagcaatacctgtatcgatgctaacaagcaagca
gccataaacttatttcttggctacttccaaccacaggaaggaaaacctgcactctgggag
ctagagtcatcttcagtggatcatatcgctgtgcacgcacgtacaataaaaagagtgaga
tcagatggcagcattctttatggaagcaacacatccatatctggatgtagtggttgccat
aatgaagacaaggagctgttgaatgcagcaccgcttgatgttaaaagtgggtcacaattt
ccagtgttggaatctgattcagtacatggcaatgaaatttcattgacctgtgaaagtgag
gtatcaaacttaaggtatacacctatgatacctcagacacatcatgttccaggcggcgtt
gaaactgaaagtagcattcattctggtgattcaaactttctggatcttgaatggctttca
acttcaggcaactcaagcgatgaaaggtccattgcaattagtactccagatgtgaacctt
tcagcggagaatgttataagtggcataaattctgagaccatggaaaatcaagatgctgat
atctatactcagaatttacctgagcatttcgtgcagtgggttaaccacggagacaccttt
tggtattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331839
Entry
4331839           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phosphatase SAC2 isoform X1
  KO
K22913  phosphatidylinositol 3,5-bisphosphate 5-phosphatase [EC:3.1.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4331839
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     4331839
SSDB
Motif
Pfam: Syja_N WYL
Other DBs
NCBI-GeneID: 4331839
NCBI-ProteinID: XP_015630612
LinkDB
Position
3:4327727..4336024
AA seq 784 aa
MEAMAGDKFLQKFRLYETRSKFYLIGRDKTRTLWRVLKIDRMEPTELEIEEDHTSYTENE
CQELLWRIHEGNRLTGGLKFVTKCYGIVGFIKFLGPYYMVLITRRRKVGTICSHEIYSVG
KSELIAIPSPIVWPNVAYSRDENRYKRLLCSVDLSKDFFFSYSYNIMRSLQKNITDKNTG
QVVYETMFVWNEFLSRAIRNHLKNTTWTVALIHGFFKQSKLSVAGKEFWLTLIARRSRHF
AGTRFLKRGVNEKGRVANDVETEQIVFEDTPDEIPHQISSVVQHRGSIPLIWFQETSRLN
IRPDIILKPDVDYKTTRLHFENLALRYGNPIIILNLIKTREKKPRESLLRAEFAKAIHYI
NKGLPDDKRLKFLHMDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASS
GQGAVANSGDIENIQDQNLCATKLVPLLLQKGVLRTNCIDCLDRTNVAQFAYGLAALGRQ
LHVLQLNETPTIELHAPLADDLMDFYERMGDTLAIQYGGSAAHNKIFCEQRGQWKAATQS
QEFLRTLQRYYSNAYTDPEKQDSINVFLGHFQPQEGKPALWKLDSDQHYNIGRQGTLTEE
TGSRSFIKRSLSDGNILCDNTGGPVSDCNVGKNNTSSELLPMQPLEDIREPSDSAPEISI
EPNPCSSTNYSTLSGRHSISEERQNYLRRLGYPELHSSNFLDLDLLSSSGNSCEEEIYER
SSLINSPMDVVSIESTTSYSEQGHNDEQGRDDTDLSRSSSQMSDIRDYSDRFTHWVDGGG
MLCY
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggaggctatggcgggcgacaaattccttcagaagttccggctctacgagaccagatcg
aaattttatcttatcggaagggacaagacaaggactctatggagggtgctgaagattgac
aggatggagcctactgagctggaaatcgaggaagatcatacaagttacacagagaatgaa
tgccaagaactgctgtggcgaattcatgaggggaatagattgactggtggactgaaattt
gtcacgaaatgctatggaatagttggttttataaaatttcttggcccttattacatggtt
ctaattaccagaagaaggaaagttggtacaatctgcagtcatgaaatatattctgtcggc
aagagcgaattgattgcaattccaagtcctattgtgtggcccaacgtggcttattctagg
gatgagaacagatataaacggctcctttgctcggtcgatctctcgaaagacttcttcttc
agctactcttacaatatcatgcgcagccttcagaagaacataactgacaagaatactggg
caagttgtttatgagacaatgtttgtttggaacgagtttctgtctcgagctatccggaac
catctcaagaatacaacgtggactgttgccttaatccatggattttttaaacagtcaaag
ctctcagtagctgggaaggaattctggttgacacttatagcaaggcgctcacgtcatttt
gctggaaccagattcttgaaaagaggtgttaatgaaaagggtagggttgccaatgatgtt
gagactgaacaaattgtttttgaggacacaccagatgaaataccacatcagatatcatct
gttgtacaacatagaggatccatacctcttatatggtttcaggaaacttcaagactcaac
attaggccagatatcatactgaaaccggatgtagactacaagacaactcgccttcatttt
gagaaccttgcacttagatatgggaacccaataattatcttaaacttgatcaagactcgt
gagaagaaacctcgtgaatctttgctccgtgcagaattcgcaaaggctatacattatatt
aacaaggggctgccagatgacaaacgtctaaagtttttacacatggatctgagtaagctt
tctagaaggaaaggtaccaatgtgctttcgctgttgaacaaggtagcatcagatgtgttg
gatctaactgacttcctccactgtgagataactacatcaaagtatgaggatgcatcaagt
ggacaaggagctgttgccaactcaggtgacatcgaaaacatccaggatcaaaatttatgt
gcaactaagctagtacctcttttactgcaaaagggtgtcctcaggactaactgcatagac
tgcttggaccgcacaaatgttgcacagtttgcgtatggcttagctgctttagggcgtcaa
cttcatgtgctccagctcaatgaaacccctacaattgaattgcatgctcctttggccgat
gatcttatggatttctatgaacggatgggtgatacgctagctattcaatatggtggctct
gctgctcacaacaagatcttctgtgagcaaagaggccaatggaaggcagcaacacaatct
caggagttcctccggacccttcagcgctactacagtaatgcctacactgatcctgagaag
caggattctataaatgtgttcttgggtcatttccaaccacaagaaggaaaacctgcgctt
tggaaattggactcagatcagcattacaacattggcaggcaaggaactttaactgaagaa
actgggagcagatcattcataaagaggtcgttatcggacggtaatattttatgtgacaac
actggtggacctgtatctgactgtaatgttggaaaaaacaacacaagctcagaattgctc
ccaatgcaaccactggaggatattagagaaccttctgattctgcaccagagatctctata
gaacctaacccgtgctccagtacaaactatagcacattgtctgggagacactcaatttca
gaagagcggcagaattatttgagaagattgggttatcctgaattgcactcttcaaacttt
cttgatcttgatctgttatcatcttcaggaaattcttgtgaggaggaaatttatgagagg
tcatcactcatcaattcacccatggatgttgtcagtattgaatcaactacatcatacagt
gaacagggacacaatgatgagcagggaagagatgacacagatctgtcacgctcaagcagc
caaatgtcagacatccgtgactactctgaccgcttcacgcattgggtggatggcggaggc
atgctttgctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340387
Entry
4340387           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phosphatase SAC3
  KO
K22913  phosphatidylinositol 3,5-bisphosphate 5-phosphatase [EC:3.1.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4340387
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     4340387
SSDB
Motif
Pfam: Syja_N
Other DBs
NCBI-GeneID: 4340387
NCBI-ProteinID: XP_015643718
UniProt: B9FRZ0 Q69YB0
LinkDB
Position
6:complement(4844480..4854769)
AA seq 803 aa
MAVEAEAEVEVEVEAGGCLLQSFELYEAESKFYILGTNTDKTSWKLLKIDRIEPSELNID
ESSTVYSHSGYLDLLKVLDEDHRSTGGVKFVTKCFGIIGFIKFLGPYYMLIITEQRKIGA
IFGHPVYQVTRTAMIELSNSESRAKFLNSKDEDRYKKLLQTIDLRKDFFFSHSYNIMRSF
QKNFNDPKEGWDLYDTMFVWNEFLTRGVRNILKSTIWTVALVYGFFKQDKLAISGKDIML
TLVARRSRHYAGTRYLKRGVNDEGSVANDVETEQIIFEDMLGPKQISSVVQNRGSIPLFW
SQETSKLNLKPDIILHEKDKNYEATRLHFENLRIRYGNPIIILNLIKKRERRPRESILRS
EFDKAIKIINNDLPGENHLRFLHWDLHKNSQRKSTNALQMLLKVAFEALNLTEFFYYQVP
PARRAESSFNLHAPLKNGFGPHECDDSNNDDITDCIDNIDDMSQEDTCGSSDTSGNGTAE
DIAEGNGSISVKPPKFQKGVLRTNCIDCLDRTNVAQYAYGLAALGHQLHALGSIESPELD
LDSPLAHHLMHFYERMGDTLAVQYGGSAAHNKIFSAKRGHLKFAIQSQEFFRTLQRYYSN
AYMDAYKQAAINLFLGYFQPCEGEPALWELEPVAGEGVLGENASKLMKRARSDGSILRKS
NASMSSNGRNGVLKSSFIDSKSELQSPNSSSDAINEISSAPDNTVTVSKSRYTPTEPHVK
HVSCELDYCNGSGDSNFLDIDWLSSSDNERPTTISTPDVNASADSVSAGVSSRRTEDHAA
EIQAQGLSEHFVQWIDQGETFWF
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggcggtggaggcggaggcggaggtggaggtggaggtggaggcggggggatgcctcctg
cagagcttcgagctctacgaggccgagtcgaaattctatattctcggaactaacactgac
aaaacatcatggaaactactcaagattgatagaatcgaaccatcagagctcaacattgat
gagagttcaactgtgtactcacatagtggatatcttgatctgctaaaggttcttgatgaa
gaccacaggtcaactggtggagtaaaatttgttacaaaatgttttggaatcatcggtttc
attaagttcctcggaccttattacatgctaatcatcaccgagcagagaaaaattggggct
atatttggccatccagtttaccaagttactaggactgcaatgattgagctgtcaaattcc
gagtcgagggcaaaatttctaaattccaaggatgaagacagatacaagaagctcttgcag
acaattgatcttagaaaggacttcttttttagccactcgtataatatcatgagaagtttc
cagaagaattttaatgatccaaaggaaggatgggacctgtatgacacaatgtttgtatgg
aatgagtttctaacacgaggggttcgcaacattctaaaaagtaccatatggactgttgcg
ttggtctatggcttttttaaacaggataaactcgcaatatctgggaaagacattatgctg
acgcttgttgctagacgctcgaggcattatgctggcaccaggtatttaaagagaggtgtg
aatgacgagggtagtgtagcaaatgatgttgagactgagcaaattatttttgaggacatg
cttggaccaaagcaaataagctctgttgtgcagaacagaggttccattcccctattctgg
tctcaggagacatccaagctgaatcttaagcctgatatcatattgcatgaaaaggacaag
aattatgaagctaccagacttcattttgaaaatcttaggataagatatggaaatcctata
atcatcctaaacttgattaagaaacgtgagaggaggccacgtgaatctatactccgcagt
gaatttgataaagcaataaagattataaataatgatctaccaggggaaaatcatctgcga
tttttacattgggatcttcataaaaactctcaaagaaaaagtacaaatgccctccaaatg
cttttgaaagtggcttttgaagctctgaacttgacagagttcttttactatcaagttcct
ccagctcgaagggctgagagttccttcaatttgcatgctccattgaagaatggttttggt
cctcatgaatgtgatgacagcaacaatgatgatatcacagactgtatcgataatattgat
gatatgtcccaagaagatacttgtggcagttctgatacttctggtaatggaactgcagaa
gatatagccgagggcaatggatctatatcagtaaagcctccaaaatttcaaaagggtgtc
ctacgtacgaactgtatagactgtttggaccgtacaaatgttgctcagtatgcgtatggt
ttagctgctcttggacatcagttgcatgcacttggttctatagaatcccctgaacttgat
ttggactcccccttggctcaccatttgatgcatttttatgagcggatgggtgacacactt
gctgtacagtatggcggttcagctgctcataacaagatattctctgcaaagagaggacac
ttaaagttcgctatccagtcgcaagagttcttcaggacactgcaaagatactacagtaat
gcatatatggatgcttacaaacaagcagcaataaacttatttttaggatacttccagcca
tgtgaaggtgaacctgcactttgggagttagaacctgttgctggggagggtgtccttggt
gagaatgcaagtaaattgatgaaaagggcaaggtcagatggcagcattcttcggaaaagc
aacgcatccatgtccagcaatggtcgaaatggagtgttaaagtcatcatttattgattct
aaaagtgagcttcaatctccaaacagttcttctgatgcaataaacgaaatttcatcagca
cctgataatacagttacagtgtcaaaatcaaggtatactcccacggaacctcatgttaag
catgtaagctgtgagcttgattactgcaatggttctggtgattcaaatttcctggacatt
gactggctttcatcttcagacaacgaaaggccaacaaccataagtactcctgatgtgaat
gcttcagccgatagtgtttctgctggtgtatcctctaggagaacggaagatcatgctgca
gagattcaggctcaggggttatcggagcattttgttcagtggattgatcaaggggagacc
ttttggttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344468
Entry
4344468           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phosphatase SAC1 isoform X1
  KO
K22913  phosphatidylinositol 3,5-bisphosphate 5-phosphatase [EC:3.1.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4344468
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     4344468
SSDB
Motif
Pfam: Syja_N
Other DBs
NCBI-GeneID: 4344468
NCBI-ProteinID: XP_015649888
UniProt: B9FYP8
LinkDB
Position
8:451126..458175
AA seq 895 aa
MTAEADDPTAAETLEKFRLYETRARFYLIGTSREKRWFQVLKIDRSERSELNISEDPVWY
SQQEVKNLLQRISEGNRSTGGLTFVTKAYGIAGCIKFLESYYLILVTKRCQIGCICGHPI
YCIDESQMITIPHSSVQTDVATSKNELRYKKLLASVDLTKDFFYSYTYPIMQSLQQNVTS
AGMKEMPYENLFVWNTFLTQPIRSRCRNTLWTVALVHGHFKQVKLSIFGRELNVVLISRR
SRHFAGTRYLKRGVNDHGKVANDVETEQIVFEEEAGSWKGRMSAVVQMRGSIPLFWSQEA
GRLSPKPDIIVQRYDPTYEATKLHFDDVAQRYGHPIIILNLTKTFEKRPREMMLRREYFN
AVGYLNQNVPEEKKLRFIHWDFHKFAKSKSANVLGVLGGVASEALDLTGFYYSGKPKVQK
KRSTQLSRTTTARDGSIDIRASSGDLSRLSSNADSLGPTASQDIRKDDSKQELLGDGPCY
QTGVLRTNCMDCLDRTNVAQYAYGLAALGRQLHAMGATNVSKIHPDSSIASALMDLYQSM
GDALAHQYGGSAAHNTVFPERQGKWKATTQSREFLKSIRRYYSNAYTDGEKQDAINLFLG
YFQPQDGKPALWELDSDYYLHVTTYGDDLISDSYHMTSSTGNSAPGESGAALSPGATLSP
VPACKEDFSRMKLTSFDKLIERTCSSIRNVRLHCDADLKQSGTVGTSGMAPDAVEIQLRT
PNWLFGQRKHAETVPTVKVIPVENANEGNGEDTNVSLCGELNWLSSADTCEEDNFRRYLA
FTTADVENGWYGGTLIYDQDENSGAYKHYSEFCQGSVMDPLEHDPEKEMHYAEALSVDID
ITDDATVEAEMQAALDDYQIIGSDLSIIPSCGSLAEDPSQLTRWIIGDDKLQVAQ
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgacggcggaggcggacgacccgacggcggcggagacgctggagaagttccgcctctac
gagacgcgcgcgaggttctacctgatcgggacgtcgcgggagaagcggtggttccaggtg
ctcaagatcgaccgctccgagcgctccgagctcaacatcagcgaggaccccgtctggtac
tcccagcaggaggtcaagaacctcctccagcgcatctccgagggcaaccgctccactggc
ggcctcaccttcgtcaccaaggcctatggcatcgctggttgcatcaagttcttggagtca
tattatctgattttggtcaccaagcgctgccaaattggttgcatttgtgggcatcctatt
tactgtatagatgagagccagatgataaccattccacactcatctgtgcagacagatgtt
gcaacctctaagaatgagctaaggtacaagaaacttttggctagtgttgatctcaccaag
gatttcttctatagctacacataccccattatgcagagcctgcagcagaatgttacttct
gcagggatgaaggaaatgccttatgaaaatttatttgtctggaatactttcctgacacag
ccgattcggtcaaggtgccgcaatactctctggacagtagcgctggtccatgggcatttc
aagcaggtcaagctatcaatatttggcagggagctaaatgttgttctcatttctagaaga
tcacggcattttgcagggacacggtatttgaaaagaggcgtgaatgaccatggaaaagtt
gctaacgatgttgaaactgagcaaatagtctttgaggaggaagctggttcctggaaggga
agaatgagtgcagtagtacagatgcggggatcgatccctctcttttggtcgcaggaggct
ggccgacttagtcctaagcctgatattattgtgcagagatatgatcctacatatgaagca
actaagttacattttgatgatgtcgctcagcgctatgggcatcctatcataatacttaat
ttaacaaagacttttgagaaaaggccccgagagatgatgctcaggcgtgaatattttaac
gcagttggatatcttaatcaaaatgtcccagaggagaagaaattgagattcatccactgg
gatttccataaatttgcaaaaagtaagtctgcaaatgttctgggtgttttaggaggtgtt
gctagtgaagcactggatctcactggattttactacagtggaaagccaaaagttcaaaag
aaaaggtcaactcagcttagtagaactaccaccgcaagggatggttccattgatataaga
gctagttctggagacctttcaaggctttcgagtaatgcagattcacttggtcccactgct
tctcaagatataagaaaagatgacagcaaacaagaacttcttggtgatggtccttgttat
caaactggagttcttcgtacaaattgcatggattgcctggatcgtacaaacgttgctcag
tatgcttacggccttgctgctttgggaaggcagcttcatgcaatgggagcgactaatgtt
tcaaaaatccacccagatagcagcattgcttcagctttaatggatttgtaccagagcatg
ggtgatgcacttgctcatcaatatggaggctcagcagcacataacacagttttccctgag
aggcaagggaagtggaaggctaccactcagtctcgggagttcctcaaatcaattagacgg
tattacagcaatgcctatactgatggtgagaaacaagatgccataaatctatttttgggt
tatttccaacctcaagatggaaagcctgctctctgggaattagactctgattactatctt
catgtgacaacatatggcgatgatcttatatctgatagctaccatatgacctcctcaact
ggaaatagtgcacctggggaatctggagctgcattgagccctggagccacattgagccct
gttccagcatgtaaggaggacttctcaaggatgaaacttacttcatttgacaaacttatt
gaaaggacttgcagttcaataaggaacgtgcggcttcactgtgatgctgatctgaaacag
agcggaactgttggaacttctggaatggccccagatgcagtggagatacagcttagaacc
ccaaactggttgtttggtcaaagaaaacacgcagagactgtcccaacagtaaaagttatt
ccagtggaaaatgcaaatgagggtaacggggaggacacgaatgtttctctatgtggggaa
ttgaattggctttcgtcagcagatacatgcgaggaggacaatttcagaaggtatcttgca
ttcacaacagcggacgtagagaatggctggtatggtggaacactgatatatgatcaagat
gaaaacagcggggcttataaacattactctgaattttgccagggctcagtcatggatccc
ctcgagcacgatcccgagaaagaaatgcattatgcggaggccctcagcgtggatattgac
atcactgatgatgcaacggtagaagcagaaatgcaagctgccctggacgattaccagata
ataggttcagacctcagcattattccatcttgtggatcgctcgctgaagatccaagccag
ctgacgaggtggatcattggtgatgataaactgcaagtcgcacagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272078
Entry
9272078           CDS       T01015                                 
Name
(RefSeq) phosphoinositide phosphatase SAC1
  KO
K22913  phosphatidylinositol 3,5-bisphosphate 5-phosphatase [EC:3.1.3.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9272078
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     9272078
SSDB
Motif
Pfam: Syja_N
Other DBs
NCBI-GeneID: 9272078
NCBI-ProteinID: XP_015642053
LinkDB
Position
6:14571198..14575910
AA seq 370 aa
MQSLQQNVTSAGMKEMPYENLFVWNTFLTQPIRSRCRNTPWTVALVHGHFKQVKLSIFGR
ELNVVLISRRSRHFAGTRYLKRGVNDHGKVANDVETEQIVFEEEAGSWKGRMSAVVQMRG
SIPLFWWQEAGRLSPKPDIIVQRYDPTYEATKLHFDDVAQRYGHPIIILNLTKIFEKRPR
EMMLRREYFNAVGYLNQNVPEEKKLRFIHWDFHKFAKSKSANVLGVLGGGASEALDLTGF
YYNGKPKVQKKRDGSIDTRASSGDLPRLSSNADSLGPTASQDIRKDDSKQELLGDGPCYQ
TGVLRTNCMDCLDRTNVAQYAYGLAALGRQLHAMGATNVSKIHPDSSIASALMDLYQSMG
DALVGSNHKN
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcagagcctgcagcagaatgttacttctgcagggatgaaggaaatgccttatgaaaat
ttatttgtctggaatactttcctgacacaaccgattcggtcaaggtgccgcaatactccc
tggacagtagcactggtccatgggcatttcaagcaggtcaagctgtcaatatttggcagg
gagctaaatgttgttctcatttctagaagatcacggcattttgcagggacacggtatttg
aaaagaggcgtgaatgaccatggaaaagttgctaacgatgttgaaactgagcaaatagtc
tttgaggaggaagctggttcctggaagggaagaatgagtgcagtagtacagatgcgggga
tcgatccctctcttttggtggcaggaggctggccgacttagtcctaagcctgatattatt
gtgcagagatatgatcctacatatgaagcaactaagttacattttgatgatgtcgctcag
cgctatgggcatcctatcataatacttaatttaacaaagatttttgagaaaaggccccga
gagatgatgctcaggcgtgaatattttaacgcagttggatatcttaatcaaaatgtccca
gaggagaagaaattgagattcatccactgggatttccataaatttgcaaaaagtaagtct
gcaaatgttctgggtgttttaggaggaggtgctagtgaagcactggatctcactggattt
tactacaatggaaagccaaaagttcaaaagaaaagggatggttccattgatacaagagct
agttctggagaccttccaaggctttcgagtaatgcagattcacttggtcccactgcttct
caagatataagaaaagatgacagcaaacaagaacttcttggtgatggtccttgttatcaa
actggagttcttcgtacgaattgcatggattgcctggatcgtacaaacgttgctcagtat
gcttacggccttgctgctttgggaaggcagcttcatgcaatgggagcgactaatgtttca
aaaatccacccagatagcagcattgcttcagctttaatggatttgtaccagagcatgggt
gatgcacttgtaggatcgaatcacaagaactaa

DBGET integrated database retrieval system