KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330943
Entry
4330943           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 7
  KO
K03061  26S proteasome regulatory subunit T1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4330943
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4330943
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4330943
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_2 AAA_16 AAA_5 AAA_33 RuvB_N DUF815 AAA_18 AAA_7 AAA_28 RNA_helicase AAA_24 TIP49 Mg_chelatase IstB_IS21
Other DBs
NCBI-GeneID: 4330943
NCBI-ProteinID: XP_015627290
UniProt: P0DKJ9 P0DKK0
LinkDB
Position
2:complement(33315467..33319256)
AA seq 426 aa
MAPEPEDDIMNEKNPRPLDEDDIALLKTYGLGPYSTSIKKVEKEIKEMAKKINDLCGIKE
SDTGLAPPSQWDLVSDKQMMQEEQPLQVARCTKIISPNTDDAKYVINVKQIAKFVVGLGD
KVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKM
REVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQ
KYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLD
GFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTQIFKIHTRTMNCERD
IRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKVIKGYQKFSATP
KYMVYN
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcgccggagccggaagacgacatcatgaacgagaagaacccccgcccgctcgacgag
gacgacatcgctctcctcaagacctacgggcttgggccatactccacaagcattaagaag
gtggagaaagaaataaaagaaatggctaagaagatcaatgacctttgtgggattaaggag
tctgacactgggctggcaccacccagccaatgggatctagtatcagataagcagatgatg
caagaagagcaaccgctgcaagtggctaggtgtaccaagattataagtcctaatactgat
gatgctaaatatgtgattaatgtaaaacaaattgcaaagtttgtggttggcctaggggat
aaagtttctccaactgacattgaggaagggatgagagtgggtgttgatcggaacaagtac
cagattcaaattcctttgccacccaaaattgacccaagtgttaccatgatgacagttgag
gaaaaacctgatgtgacatataatgatgtgggtggttgcaaggaacagattgaaaaaatg
cgggaggttgttgagcttcccatgcttcacccagagaagtttgtcaagcttggtattgat
cctccaaagggggtcctttgctatggccctcctggaactggcaaaacacttcttgctaga
gcagtggccaatcgtacagatgcttgttttatccgtgtaattggcagtgagttagttcaa
aaatatgttggtgaaggggcacggatggtccgggaattatttcagatggcccgctcgaag
aaagcatgcattgtcttctttgatgaggttgatgctattggaggtgctcgcttcgatgat
ggggttgggggtgataatgaggttcagcgtaccatgttggaaattgtgaaccaactcgat
gggtttgatgcgaggggaaacatcaaggttctgatggccacaaacaggcctgatacctta
gatcctgcacttctacgtcctggtcgtttggacaggaaggtagaatttggcttacctgac
ctggagggccgtacccaaatattcaagatacatacacgcaccatgaactgtgagcgcgat
atccgtttcgagctgctggctcgcctctgccccaactcaactggagctgatataaggagt
gtctgcacagaagctggcatgtatgcgattcgcgcccgacggaaaacagtgactgagaag
gacttccttgatgctgtaaacaaggtcatcaaagggtatcagaagttcagcgcgactcca
aaatacatggtgtataactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340376
Entry
4340376           CDS       T01015                                 
Name
(RefSeq) 26S protease regulatory subunit 7
  KO
K03061  26S proteasome regulatory subunit T1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4340376
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4340376
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     4340376
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_2 AAA_16 AAA_5 AAA_33 RuvB_N DUF815 AAA_18 AAA_7 AAA_28 RNA_helicase AAA_24 TIP49 Mg_chelatase IstB_IS21
Other DBs
NCBI-GeneID: 4340376
NCBI-ProteinID: XP_015644004
UniProt: P0DKJ9 P0DKK0
LinkDB
Position
6:4667475..4670858
AA seq 426 aa
MAPEPEDDIMNEKNPRPLDEDDIALLKTYGLGPYSTSIKKVEKEIKEMAKKINDLCGIKE
SDTGLAPPSQWDLVSDKQMMQEEQPLQVARCTKIISPNTDDAKYVINVKQIAKFVVGLGD
KVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKM
REVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQ
KYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLD
GFDARGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTQIFKIHTRTMNCERD
IRFELLARLCPNSTGADIRSVCTEAGMYAIRARRKTVTEKDFLDAVNKVIKGYQKFSATP
KYMVYN
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcgccggagcccgaggacgacatcatgaacgagaagaacccgcgcccgctcgacgag
gacgacatcgccctcctcaagacctacggtcttggaccttactcgaccagcattaagaag
gttgagaaggaaatcaaagagatggcgaagaagataaatgatctctgtggaattaaagag
tctgacactggattggctccacctagccagtgggaccttgtatccgataagcagatgatg
caggaggagcaacccctgcaggttgcaagatgcacaaagatcatcagccctaacacggac
gatgctaaatatgtcatcaatgtcaagcaaattgcgaagtttgtggttgggttgggcgac
aaggtctcccccactgatatcgaggaaggaatgcgggttggagttgatcgaaacaagtac
caaattcaaattcctttgccaccaaagattgatcccagcgttaccatgatgactgtggaa
gaaaaaccagatgtgacttacaatgatgttggtggatgcaaggagcagattgagaagatg
cgtgaggtggttgagcttcctatgcttcacccagaaaagtttgtcaaacttggtatcgat
cctcctaagggagtactgtgttatggccctcctggaactgggaaaacacttcttgctagg
gcagtggccaaccgcacggatgcttgctttattcgagtcataggaagtgagctagttcag
aagtatgttggtgagggggcccgcatggttcgggaactcttccaaatggcacgatcgaag
aaggcttgcattgtcttctttgatgaagtcgatgccatcggtggtgctcgctttgacgat
ggtgttggtggtgacaatgaggtccagcgcactatgcttgagattgttaatcagcttgat
ggatttgatgccaggggaaacatcaaggtcctcatggccaccaacaggcccgataccttg
gaccctgcattactacgtccagggcgtctggacaggaaagttgagtttggcctgccagac
ctggagggccggacccagatcttcaagatccacactcgcaccatgaactgcgagcgggac
atccggtttgagctgctcgctcgcctctgccccaactccactggggccgacatacggagt
gtgtgcacggaggctggcatgtacgccatccgcgctcgcaggaagacggtgacagagaag
gatttcttggacgcggtgaataaggtgatcaagggttaccaaaagttcagcgcaacgccc
aagtatatggtgtacaactag

DBGET integrated database retrieval system