KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330946
Entry
4330946           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L35a-1
  KO
K02917  large subunit ribosomal protein L35Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4330946
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4330946
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4330946
  Archaea
    4330946
SSDB
Motif
Pfam: Ribosomal_L35Ae
Other DBs
NCBI-GeneID: 4330946
NCBI-ProteinID: XP_015627611
UniProt: A0A0P0VQE4 Q6K8U8
LinkDB
Position
2:33359338..33361384
AA seq 112 aa
MVKGRTGQRVRLYVRGTILGYKRSKSNQYENTSLVQIEGVNTKEEVAWYCGKRMAYVYKA
KTKSGGTNYRCIWGKVTRPHGNSGVVRAKFKSNLPPASMGRKVRVFMYPSSI
NT seq 339 nt   +upstreamnt  +downstreamnt
atggtgaagggacgcaccgggcagcgcgtgcggctctacgtccgcggcaccatcctcgga
tacaagaggtcgaagtcgaaccagtacgagaacacgtcgctggtgcagatcgagggggtg
aacaccaaggaggaggtggcgtggtactgcgggaagaggatggcgtacgtgtacaaggcc
aagaccaagagcggcggcacgaactaccgctgcatctggggcaaggtcacccgcccccat
ggcaactccggcgtcgtccgcgccaagttcaagtccaacctgccccccgcttccatgggg
cgcaaggtcagagtcttcatgtacccgagcagcatctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339572
Entry
4339572           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L35a-2
  KO
K02917  large subunit ribosomal protein L35Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339572
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339572
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339572
  Archaea
    4339572
SSDB
Motif
Pfam: Ribosomal_L35Ae DUF2080
Other DBs
NCBI-GeneID: 4339572
NCBI-ProteinID: XP_015637381
UniProt: Q6I608 B9FHW4
LinkDB
Position
5:27695297..27697301
AA seq 111 aa
MKGRQGQRVRLYVRGTILGYKRSKSNQYENTSLLQIEGVNTKEEVGWYAGKRIAYVYKAK
TKSNDSTIRCIWGKVTRPHGNSGVVRAKFRSNLPPTSMGKKVRVFMYPSSI
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaagggacggcaaggccagcgcgtgaggctgtacgtccgcggcaccatcctcggctac
aagaggtcgaagtcgaaccagtacgagaacacgtcgctgctgcagatcgagggggtgaac
accaaggaggaggttgggtggtacgccgggaagcgcatcgcctacgtctacaaggccaag
acgaagagcaacgactccaccatccgctgcatctggggcaaggtcacccgcccgcacggc
aactccggtgtcgtccgcgccaagttccggtccaacctcccgcccacctccatgggcaag
aaggtccgcgtcttcatgtaccccagcagcatctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271790
Entry
9271790           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L35a-2
  KO
K02917  large subunit ribosomal protein L35Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9271790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9271790
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9271790
  Archaea
    9271790
SSDB
Motif
Pfam: Ribosomal_L35Ae DUF2080
Other DBs
NCBI-GeneID: 9271790
NCBI-ProteinID: XP_015639361
UniProt: Q6I608 B9FHW4
LinkDB
Position
5:27640640..27642716
AA seq 111 aa
MKGRQGQRVRLYVRGTILGYKRSKSNQYENTSLLQIEGVNTKEEVGWYAGKRIAYVYKAK
TKSNDSTIRCIWGKVTRPHGNSGVVRAKFRSNLPPTSMGKKVRVFMYPSSI
NT seq 336 nt   +upstreamnt  +downstreamnt
atgaagggacggcaaggccagcgcgtgaggctgtacgtccgcggcaccatcctcggctac
aagaggtcgaagtcgaaccagtacgagaacacgtcgctgctgcagatcgagggggtgaac
accaaggaggaggttgggtggtacgccgggaagcgcatcgcctacgtctacaaggccaag
acgaagagcaacgactccaccatccgctgcatctggggcaaggtcacccgcccgcacggc
aactccggcgtcgtccgcgccaagttccggtccaacctcccgcccacctccatgggcaag
aaggtccgcgtcttcatgtaccctagcagcatctaa

DBGET integrated database retrieval system