KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330975
Entry
4330975           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronate 4-epimerase 1
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4330975
   00520 Amino sugar and nucleotide sugar metabolism
    4330975
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     4330975
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 adh_short NmrA
Other DBs
NCBI-GeneID: 4330975
NCBI-ProteinID: XP_015623004
UniProt: Q6K9M5 A3AC62
LinkDB
Position
2:33618246..33620249
AA seq 437 aa
MRVLEDDMFPSTPGKVKIERATAMNRQLHRCFASTSTMFLWALFLVAMTASYLSFQSFVD
TSSKYFAASWGGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRG
DGVVGIDNFNSYYDPSLKKARRSLLASHGVFVIEGDINDGRLLAKLFDVVPFTHVLHLAA
QAGVRYAMENPASYVHSNIAGLVTLLEACKDADPQPAIVWASSSSVYGLNDKVPFTESDR
TDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNILQGK
PITVYRGKNRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYRIFNLGNTSP
VTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLARQQLGYKPTTNLDVGLKKF
VKWYLSYYGYTRGSKNL
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgcgggtgctggaggacgacatgttcccgtcgacgccggggaaggtgaagatcgagagg
gcgacggcgatgaaccgccagctccaccgctgcttcgcgtcgaccagcaccatgttcctc
tgggcgctcttcctcgtcgccatgaccgcgtcgtacctcagcttccagtccttcgtcgac
acctcgtccaagtacttcgccgcctcctggggcgggctgcactgggagcgccagatccgc
gcgtccgccgcgccgaggcggccgcccgggtcggcggcgggcgcggggatgtcggtgctc
gtgacgggcgccgccgggttcgtcggcacgcactgctccctcgcgctccgcaagcgcggc
gacggcgtcgtcggcatcgacaacttcaactcctactacgacccctcgctcaagaaggcg
cgcaggtcgctgctcgcctcgcacggggtgttcgtcatcgagggcgacatcaacgacggc
cgcctcctcgccaagctcttcgacgtcgtgcccttcacgcacgtgctccacctcgcggcg
caggcgggcgtgcgctacgccatggagaacccggcgtcctacgtgcactccaacatcgcc
ggcctcgtcaccctcctcgaggcatgcaaggacgccgacccgcagccggccatcgtctgg
gcctcctcctcctccgtctacggcctcaacgacaaggtgcccttcacggagagcgaccgc
actgaccagccggcgtcgctgtacgccgccaccaagaaggccggcgaggagatcacccac
acgtacaaccacatctacggcctctccatcaccggactccgcttcttcaccgtgtacggg
ccatgggggcggccggacatggcctacttctccttcacccgcaacatcctgcaggggaag
cccatcacggtgtaccgcggcaagaaccgcgtcgacctcgcccgcgacttcacctacatc
gacgacatcgtcaagggctgcctcggctcgctcgacacggccgggaagagcaccggcacc
gggggcaagaagcgcgggccggcgccctacaggatcttcaacctcggcaacacctcgccg
gtgacggtgcccaacctggtgtccatcctggagaagcacctccgcgtgaaggccaagaag
aacgtggtcgagatgcccggcaatggcgacgtgccattcacgcacgccaacatctccctc
gcgaggcagcagctcggctacaagccgaccaccaacctcgacgtcgggctcaagaagttc
gtcaagtggtacctctcctactacggctacaccaggggatccaagaacttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332258
Entry
4332258           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronate 4-epimerase 3
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4332258
   00520 Amino sugar and nucleotide sugar metabolism
    4332258
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     4332258
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 KR NmrA
Other DBs
NCBI-GeneID: 4332258
NCBI-ProteinID: XP_015628152
UniProt: A0A8J8YG27 Q2MJA7
LinkDB
Position
3:7889247..7891293
AA seq 484 aa
MAPQLTGAPGTAGAAGGAASVKPQFHHFHHHRLATRHHHPSPTSLLSKLAFWSVCSLSLL
LAFLLLSPSAAPAPRAAPDSPRRSLHTSSPSAAATWGGAAWEKKVRASARVRRANGRGLT
VLVTGAAGFVGCHAAAALRRRGDGVLGLDNFNDYYDPALKRGRAALLARSGVYVVDGDIA
DAELLAKLFDVVPFTHVLHLAAQAGVRHALVDPMSYVRANVGGFVALLEAARMANPQPAI
VWASSSSVYGLNSHVPFSEHDRTDRPASLYAATKKAGEEIAHAYNHIYGLSLTALRFFTV
YGPWGRPDMAYFFFTRDILAGRPITVYESAGGGTHQTTISRDFTYIDDIVKGCVGALDTA
GRSTGSGGKKRGPAPFRTYNLGNTSPVPVTQLVDLLEKLLKVKAVRKIVKMPRNGDVPYT
HANISLAQRELGYRPSTDLQTGVKKFVRWYLEYYMPGFAGKQKQHGSSNSKSSRGRSGNT
SSAR
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgccgcagctgaccggcgcgcccggcacggcgggggcggcgggcggcgcggcgtcc
gtcaagccgcagttccaccacttccaccaccaccgcctcgccacgcgccaccaccacccc
tcgccgacctcgctcctctccaagctcgccttctggtccgtctgctccctctcgctcctc
ctcgccttcctcctcctctccccctccgccgcgccggccccgcgggcggcgcccgactcc
ccgcgccgctccctccacacgtcctccccgtccgccgccgccacgtggggcggcgccgca
tgggagaagaaggtgcgggcgtccgcgcgcgtcaggcgggccaacgggcgggggctcacc
gtcctcgtcacgggcgccgcgggcttcgtcggctgccacgcggccgccgccctccgccgc
cgcggcgacggcgtgcttgggctggacaacttcaacgactactacgaccccgccctcaag
cggggccgcgccgcgctcctcgcccgctcgggggtctacgtcgtcgacggcgacatcgcc
gatgcggagctcctcgccaagctgttcgacgtcgtgccgttcacccacgtcctccacctc
gccgctcaggcgggcgttcggcacgcgctcgttgacccgatgtcctacgtgcgcgccaac
gtcggcgggttcgtggcgctgctcgaggcggcgcgcatggcgaatccccagccggcgatc
gtctgggcgtcgtcgtcttcagtgtacgggctcaactcccatgtgcctttctccgaacat
gacaggacggaccgacccgcctctctgtatgcagcgaccaagaaggccggtgaggagatc
gctcatgcctacaaccacatctatgggctctcgctcacggcgctccgtttcttcaccgtg
tatgggccgtgggggcgcccagacatggcatacttcttcttcacccgggacattcttgct
ggtcggccaatcaccgtgtatgaaagtgcaggtggaggcacacaccagaccaccatttcc
cgagatttcacctatattgatgacattgtgaaggggtgtgttggggcattggatacagcc
gggcgtagcacaggcagtggaggcaagaagcgagggccggcaccattcaggacatacaat
ttggggaacacatctcctgtgccggtgacacagctggtggatttactggagaagttgctc
aaggtgaaagcggtgaggaagattgtcaagatgccaaggaatggtgatgtgccatataca
catgctaacatcagtcttgctcagcgggagcttgggtaccgaccgtcaactgatcttcaa
acaggggttaagaagtttgtgcggtggtatctcgagtactacatgcctgggtttgctggt
aagcagaagcagcatggcagtagcaacagcaagtcttcgcgaggtcggagtggcaacaca
agcagtgcaagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340350
Entry
4340350           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronate 4-epimerase 1
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4340350
   00520 Amino sugar and nucleotide sugar metabolism
    4340350
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     4340350
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 adh_short
Other DBs
NCBI-GeneID: 4340350
NCBI-ProteinID: XP_015642719
UniProt: Q69KM5
LinkDB
Position
6:complement(4404013..4406233)
AA seq 453 aa
MRVVVEEEEAEVMYPSTPGKVKVEQRSSAAMSRQVHRCFASTGTMFLWALFLVAMTATYL
SFRSLAGDAAASSSRYFPAASWGGLHWERQIRASASPRRPPGSAEGAGLSVLVTGAAGFV
GAHCSLALRKRGDGVVGIDNYNSYYDPSLKKARRALLGSHGVFVVDGDINDGRLLAKLFD
VVPFTHVLHLAAQAGVRYAMENPSSYVRSNVAGLVSLLESCKDADPQPAVVWASSSSVYG
LNDAVPFSEAHRTDKPASLYAATKKAGEAITHTYNHIYGLSITGLRFFTVYGPWGRPDMA
YFFFTRNILQGKPVTVYRGRDHVDIARDFTYIDDIVRGCLAALDTAGRSTGGGGRKRGAA
PYRIFNLGNTSPVTVPALVAMLERCLMVKARRHVVEMPGNGDVPFTHANISLAREQLGYK
PTTSLEMGLKKFVRWYLSYYGYNRGTHAFRSRL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgcgggtggtggtggaggaggaggaggccgaggtgatgtacccgtcgacgccggggaag
gtgaaggtggagcagcggtcgtcggcggcgatgagccggcaggttcaccggtgcttcgcg
tcgacggggaccatgttcctgtgggcgctgttcctggtggcgatgacggcgacgtacctg
agcttccgctccctcgccggcgacgccgcggcgtcgtcgtcgcgctacttcccggcggcg
tcgtggggcgggctgcactgggagcggcagatcagggcgtcggcgtcgccgcggcggccg
cccgggtcggcggagggcgccgggctgtccgtgctggtcaccggcgccgccgggttcgtc
ggcgcgcactgctccctcgccctccgcaagcgcggcgacggcgtcgtcggcatcgacaac
tacaactcctactacgacccgtcgctgaagaaggcgcggcgcgccctcctgggctcgcac
ggcgtgttcgtcgtcgacggcgacatcaacgacggccgcctcctcgccaagctgttcgac
gtcgtccccttcacccacgtcctccacctcgccgcgcaggccggcgtccgctacgccatg
gagaacccctcgtcgtacgtccgctccaacgtcgccggcctcgtctccctcctcgagtcc
tgcaaggacgccgacccgcagccggccgtcgtctgggcctcctcctcctccgtctacggt
ctcaacgacgccgtccccttctccgaggcgcaccgcaccgacaagccggcgtcgctctac
gccgccaccaagaaagccggcgaggccatcacccacacctacaaccacatctacggcctc
tccatcaccggcctccgcttcttcacggtgtacggtccctggggccgccccgacatggcc
tacttcttcttcacccgcaacatcctgcaggggaagccggtcaccgtctaccggggccgt
gatcacgtcgacatcgccagggacttcacctacatcgacgacatcgtgcgggggtgcctg
gcggcgctggacacggctgggcggagcacgggcgggggcgggaggaagcgcggggcggcg
ccgtacaggatcttcaacctcgggaacacgtcgccggtgacggtgccggcgctggtggcg
atgctggagaggtgcctgatggtgaaggcgaggaggcacgtcgtcgagatgcccggcaat
ggcgacgtgcccttcacccacgccaacatcagcctggcgagggagcagctcgggtacaag
ccgacgaccagcctcgagatggggctcaagaagttcgtccggtggtacctctcctactac
ggctacaacagaggaactcacgcattcaggagccgcttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346094
Entry
4346094           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronate 4-epimerase 6
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4346094
   00520 Amino sugar and nucleotide sugar metabolism
    4346094
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     4346094
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 adh_short NmrA
Other DBs
NCBI-GeneID: 4346094
NCBI-ProteinID: XP_015648495
UniProt: Q2MJA8 Q0J4A6
LinkDB
Position
8:complement(26165056..26167242)
AA seq 478 aa
MMPHSGVVDAAAKGVKLGGGGGGALMVRRVASGKLLSASSHLLFRATILATLCLVCLFTV
HYPSLLSHSFHLSSAAAAANGKHRAASRSSHRSLLGSSAAVAYGGAAWEKEVRRSAAPRR
DGGLSVLVTGAAGFVGAHCSLALRARGDGVVGLDNFNSYYDPSLKRARQRLLASRGVAVL
DADINDAALLERLFDAARFTHVLHLAAQAGVRYAMRAPQTYVASNVAGLVSVFEVAAKHA
DPQPAIVWASSSSVYGLNTDAPFSEEHRTDRPASLYAATKKAGEAIAHAYNHIYGLSITG
LRFFTVYGPWGRPDMAYFSFARSIVAGEPITLFRTADGADARRDFTYIDDVVKGCLGALD
TAGESTGTKSGKKRGPAPLRVYNLGNTSPVPVTRMVAILEKLLGRKANKRVVTMPSNGDV
PFTHANVSHAARDFGYRPATPLDAGLRRFVDWFVHYYKLDTAKIAKGKRKSMAMSAAS
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgatgccgcactccggcgtggtggacgcggcggcgaagggggtgaagctggggggcggt
ggtggcggggcgctgatggtgcgccgggtggcgagcggcaagctcctgtcggcgtcgtcg
cacctgctgttccgggcaaccatcctggcgacgctctgcctcgtctgcctcttcaccgtg
cactacccgtcgctgctgtcccactccttccacctctcctccgccgccgccgccgcgaac
gggaagcacagggcggcgtcgcggtcgtcgcaccggagcttgcttgggtcgtcggcggcg
gtggcgtatgggggcgcggcgtgggagaaggaggtgaggaggagcgcggcgccgaggagg
gacgggggcttgtcggtgctggtgacgggcgccgccgggttcgtcggcgcgcactgctcg
ctggcgctccgggcgcgcggggacggcgtggtggggctcgacaacttcaactcctactac
gacccgtccctgaagcgggcgcggcagcgactgctggcgtcgcgcggcgtcgccgtgctc
gacgccgacatcaacgacgccgcgctgctggagcggctgttcgacgcggcgcgcttcacg
cacgtgctccacctcgccgcgcaggccggggtgcgctacgcgatgcgcgcgccgcagacg
tacgtcgcgtccaacgtcgccggcctcgtcagcgtcttcgaggtcgccgccaagcacgcc
gacccgcagccggcgatcgtgtgggcgtcctcgtcgtcggtgtacgggctcaacaccgac
gcgcccttctccgaggagcaccgcaccgaccggccggcgtcgctgtacgcggcgaccaag
aaggccggcgaggccatcgcccacgcgtacaaccacatctacggcctctccatcaccggc
ctccgcttcttcaccgtgtacgggccgtggggccgccccgacatggcctacttctccttc
gcccgcagcatcgtcgctggcgagcccatcacgctgttccgcaccgccgacggcgccgac
gcgcgccgcgacttcacctacatcgacgacgtcgtcaagggctgcctcggcgcgctcgac
acggccggcgagagcaccggcaccaagtccggcaagaagcgcggcccggcgccgctccgc
gtctacaacctcggcaacacctcgccggtgccggtcacccgcatggtcgccatcctcgag
aagctcctcggcaggaaggcgaacaagcgcgtcgtcaccatgcccagcaatggcgacgtg
ccgttcacccacgccaacgtcagccacgccgcgcgcgacttcggctaccgcccggcgacc
cccctcgacgccggcctccgccgcttcgtcgactggttcgtccactactacaagctcgac
acggccaagatcgccaagggcaagaggaaatccatggccatgtccgccgcgtcgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347499
Entry
4347499           CDS       T01015                                 
Name
(RefSeq) UDP-glucuronate 4-epimerase 6
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4347499
   00520 Amino sugar and nucleotide sugar metabolism
    4347499
Enzymes [BR:osa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     4347499
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD Polysacc_synt_2 NAD_binding_4 adh_short
Other DBs
NCBI-GeneID: 4347499
NCBI-ProteinID: XP_015651224
UniProt: B9G4F5 Q0J0N3
LinkDB
Position
9:complement(19486172..19488114)
AA seq 498 aa
MPADAAAKGMKLERYASGAGAMLLLRRAASGKVVSASSHLLFRATVLATMALVFLFTFHY
PSLLSRSFTLSSGAGAGEGGAAAHASHRSLLMSSSSASASAASVYGGAAWEKEVRRSAKP
RKDGGIAVLVTGAAGFVGTHCSLALRARGDGVLGLDNFNAYYDPELKRARQRLLAGRGVL
VLDADINDALLLEKLFDLVPFTHVLHLAAQAGVRYAMEAPQTYVASNVAGLVTVLEVAAK
HADPQPAIVWASSSSVYGLNTDAPFSEEHRTDRPASLYAATKKAGEAIAHTYNHIYGLSI
TGLRFFTVYGPWGRPDMAYFFFAKSIVSGEPITLFRAADGADARRDFTYIDDVVKGCLGA
LDTSGKSTGSSKSGKKSGPAPLRVYNLGNTSPVPVTRMVAILEKLLGKKANKRIVAMPSN
GDVPFTHANVTHAAHDFGYRPTTSLDAGLRHFVDWFADYYKLKLDVPKIAAKVAGAGKPS
SSSASKKKKKAAAMSASS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgccggcggacgcggcggcgaaggggatgaagctggagaggtacgcgagcggcgcgggc
gcgatgctgctgctgcggcgggcggcgagcgggaaggtcgtgtcggcgtcgtcgcacctg
ctgttccgcgccaccgtgctcgccacgatggcgctcgtgttcctcttcacgttccactac
ccgtcgctgctgtcgcgctccttcacgctctcctccggcgccggcgccggcgagggggga
gccgcggcgcacgcctcgcaccggagcttgctcatgtcgtcgtcgtcggcgtcggcgtcg
gcggcgtcggtgtacgggggcgcggcgtgggagaaggaggtgaggcggagcgcgaagccg
aggaaggacggggggatagccgtgctggtgaccggcgcggcggggttcgtcggcacgcac
tgctcgctggcgctgagggcgcgcggcgacggcgtgctggggctcgacaacttcaacgcc
tactacgacccggagctgaagcgcgcgcggcagaggctcctcgccggccgcggcgtgctc
gtgctcgacgccgacatcaacgacgcgctcctgctcgagaagctgttcgacctggtgccg
ttcacccacgtgctgcacctcgccgcgcaggccggcgtgcgctacgccatggaggcgccg
cagacgtacgtggcgtccaacgtggccgggctcgtgaccgtcctcgaggtcgccgccaag
cacgccgacccgcagccggcgatcgtctgggcgtcgtcgtcgtcggtgtacggcctcaac
accgacgcacccttctccgaggagcaccgcaccgaccggccggcgtcgctgtacgcggcg
accaagaaggccggcgaggccatcgcgcacacgtacaaccacatctacggcctctccatc
accggcctccgcttcttcaccgtgtacgggccatggggccgccccgacatggcctacttc
ttcttcgccaagagcatcgtctccggcgagcccatcacgctgttccgcgccgccgacggc
gccgacgcgcgccgcgatttcacctacatcgacgacgtcgtcaagggctgcctcggcgcg
ctcgacacctccggcaagagcaccggctcctccaagtccggcaagaagtccggcccggcg
ccgctccgcgtctacaacctcggcaacacctcgccggtgccggtcacccgcatggtcgcc
atcctcgagaagctcctcggcaagaaggccaacaagcgcatcgtcgccatgcccagcaat
ggcgacgtgcccttcacccacgccaacgtcacccacgccgcccacgacttcggctaccgc
cccaccacctccctcgacgccggcctccgccacttcgtcgactggttcgccgactactac
aagctcaagctcgacgtccccaagatcgccgccaaggtcgccggcgccggcaagccctcc
tcctcgtcggcctccaagaagaagaagaaggccgcggcgatgtcggcgtcatcatga

DBGET integrated database retrieval system