KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331035
Entry
4331035           CDS       T01015                                 
Name
(RefSeq) cyclin-B1-2-like
  KO
K11599  proteasome maturation protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4331035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4331035
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Assembling chaperones
    4331035
SSDB
Motif
Pfam: UMP1
Other DBs
NCBI-GeneID: 4331035
NCBI-ProteinID: XP_015626577
UniProt: Q69IK6 B9F425
LinkDB
Position
2:complement(34075902..34078165)
AA seq 141 aa
MASGGVVKKEIGGNHDVLRFGVNDSVKGDLAPPHPLQASVHKDAKFWADKKRFGAEAIYG
SAFNIRKDLDAQILSKFQRPPGALPSSMLGYEALTGSLDDFGFEDYLNLPQDSESFRAPD
MHHGMEVRLGLSKGPVCPSFN
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcgagcggcggcgtggtgaagaaggagatcggcgggaaccacgacgtcctccgcttc
ggcgtcaacgacagcgtcaagggggacctcgcgccgccgcacccgctccaggccagcgtc
cacaaggatgccaagttctgggcggacaagaagaggttcggcgcggaagccatctacgga
tccgccttcaacatccgcaaggatcttgatgcccaaatcctctccaagttccaaaggccc
cctggtgcattgccgtcatctatgctaggatatgaggcactgactggttccttagatgat
tttgggtttgaagattatcttaacttgccccaagattctgaaagcttccgtgctcccgac
atgcaccacggaatggaggttcgcctcggtttgtcaaagggacctgtttgccctagtttc
aattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333335
Entry
4333335           CDS       T01015                                 
Name
(RefSeq) cyclin-B1-2-like
  KO
K11599  proteasome maturation protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4333335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4333335
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Assembling chaperones
    4333335
SSDB
Motif
Pfam: UMP1
Other DBs
NCBI-GeneID: 4333335
NCBI-ProteinID: XP_015630271
UniProt: A0A0P0W0C2
LinkDB
Position
3:21490167..21493504
AA seq 141 aa
MASGSIVKKEVGENHDVLLFGVNNSVKGDLAPQHPIQATVHKEAKFWADKKRFGAEAIYG
SAFNIRKDLDAQILSKFQRPPGALPSSMLGYEALTGSLDDFGFEDYLNLPQDSDSFHAPD
MHHGMEVRLGLSKGPICPSFN
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcgagcggcagcatcgtgaagaaggaggtcggcgagaaccacgacgtgctcctcttc
ggcgtcaacaacagcgtcaagggcgacctcgcgccgcagcacccgatccaggccaccgtc
cacaaggaggccaagttctgggcggataagaagaggttcggggcggaagccatctacgga
tccgctttcaacatccgcaaggatctcgatgcccaaatcctctccaagttccaaaggccc
cctggtgcattgccatcatctatgctaggatacgaggcgctgactggttccttggatgat
ttcgggtttgaagattatctcaacttgccccaagattctgacagcttccatgctccagac
atgcaccacggaatggaggttcgccttggtttgtcaaagggaccgatttgccctagtttc
aattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346694
Entry
4346694           CDS       T01015                                 
Name
(RefSeq) cyclin-B1-2-like
  KO
K11599  proteasome maturation protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4346694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4346694
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Assembling factors
   Assembling chaperones
    4346694
SSDB
Motif
Pfam: UMP1
Other DBs
NCBI-GeneID: 4346694
NCBI-ProteinID: XP_015611510
UniProt: A0A0P0XKD8
LinkDB
Position
9:8636329..8639669
AA seq 141 aa
MASGSIVKKEVGENHDVLRFGFNNSVKGDLAPQHPIQATVHKEAKFWADKKRFGAEAIYG
SAFNIRKDLDAQILSKFQRPPGALPSSMLGYEALTGSLDDFGFEDYLNLPQDSDSFHAPD
MHHGMEVLLGLSKGPICPSFN
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcgagcggcagcatcgtgaagaaggaggtcggcgagaaccacgacgtgctccgcttc
ggcttcaacaacagcgtcaagggcgacctcgcgccgcagcacccgatccaggccaccgtc
cacaaggaggccaagttctgggcggataagaagaggttcggggcggaagccatctacgga
tccgctttcaacatccgcaaggatctcgatgcccaaatcctctccaagttccaaaggccc
cctggtgcattgccatcatctatgctaggatacgaggcgctgactggttccttggatgat
ttcgggtttgaagattatctcaacttgccccaagattctgacagcttccatgctccagac
atgcaccacggaatggaggttctccttggtttgtcaaagggaccgatttgccctagtttc
aattga

DBGET integrated database retrieval system