KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331042
Entry
4331042           CDS       T01015                                 
Name
(RefSeq) heparanase-like protein 3
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4331042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:osa00536]
    4331042
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     4331042
Glycosaminoglycan binding proteins [BR:osa00536]
 Heparan sulfate / Heparin
  Enzymes
   4331042
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 4331042
NCBI-ProteinID: XP_015623406
UniProt: A3ACD5 Q69II6
LinkDB
Position
2:34199424..34203705
AA seq 541 aa
MAAGLLLKLVGFCFWAVFWLGGAATVSTNAGGEAAAAAVVVDARSAIAVTDEDFVCATLD
WWPPDKCDYGTCSWGLATLLNMDLSNKILLNAVKAFSPLKLRLGGSLQDVLIYDTGDPRQ
PCTPFTKNSSAMFGFTQGCLPLHRWDELNAFFQKSGAKIIFGLNALNGRVPMSDDSLGGP
WNYTNAASFIRYTVSKGYDIHGWELGNELSGSGVGARVDADQYAQDVLALKQIIDNSYQG
HASKPLVIAPGGFFDAAWFTELISRTKPNQMDVMTHHIYNLGPGVDTHLIDKILDPSYLD
GEAGTFSSLQGILKSAGTSTVAWVGEAGGAYNSGHHLVTDAFVFSFWYLDQLGMSSKYDT
KTYCRQTLIGGNYGLLNTTTFEPNPDYYSALLWNRLMGTKVLSATFNGTNKIRAYAHCAR
DSRGITLLLINLSGNNTNHIYVTSEGVQPYSTKKEGRRRFGRIPGLGEEAQLIREEYHLT
PKDGSLQSQHVLLNGNVLAPDANGEIPKLEPVQVEGTQPITVAPYSIVFAHIPRFYAPAC
R
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggcggcggggctactgctgaagctggtcgggttctgcttctgggccgtcttctggctc
ggcggcgccgccaccgtcagcaccaacgccggcggcgaggcggcggcggcggcggtggtg
gtggacgcgcggtccgccattgctgtgacggacgaggacttcgtgtgcgcgacgctggat
tggtggccgccggacaagtgcgactacggcacctgcagctggggactcgccaccctcctc
aacatggatctttcaaacaaaatcctgttgaatgccgtcaaagcattctcacctctgaag
cttaggctgggaggatccttgcaggatgtgttgatatacgacaccggcgatcctcggcag
ccgtgcactccgttcacgaagaactcatcggccatgttcggtttcactcaaggttgcctg
ccgttgcatagatgggacgagctcaatgcattcttccaaaaatcaggagcaaaaattatc
tttgggctgaatgctctgaatggtagggttccaatgtctgatgattctttaggagggcca
tggaattacaccaatgcggcttccttcattcgctacactgtcagcaagggctatgacatc
catggatgggaactcggaaatgaactcagtggcagtggagttggagctcgagttgatgca
gaccaatatgcacaagatgttctagctctgaaacaaatcattgacaactcctaccaaggc
catgcatcaaagccactggtgatcgcaccgggaggtttctttgatgcagcctggttcact
gagcttatcagcagaacaaagccaaaccagatggatgtgatgactcaccacatctacaat
ctaggccctggcgtcgacacgcacctgattgataaaattcttgacccgtcttacctcgac
ggcgaggccggcacattcagcagtctccaggggatactgaagtctgcagggacgtccacc
gtcgcgtgggtcggcgaggctggaggcgcttacaacagtggtcaccaccttgtaactgat
gcttttgtgttcagcttctggtacttggatcagctaggaatgtcatctaagtatgacaca
aagacctactgcagacagaccttgattggagggaactatggtctgctcaacacaacaacg
tttgaaccaaaccctgattactacagtgctttactatggaaccgcctcatgggaaccaag
gttctctcggcaacattcaacggcaccaacaagatccgcgcttacgcacattgcgcaaga
gattcacgtgggatcactctactcctgatcaacctcagtggcaacaacacaaaccatatc
tacgtgacgagcgaaggcgtgcaaccttacagcacaaagaaggagggccgcagaaggttc
ggacgcatccccgggctcggcgaagaagctcagctcatcagagaagagtaccatctcacc
cccaaagatgggagcctgcagagccagcatgtgctgctgaatggcaatgtgttggcacct
gatgccaatggagagatccctaagctggagcctgtgcaggtggagggaacacagcccata
acagtggctccttactccattgtgtttgctcatattcccagattctatgctcctgcctgt
aggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332033
Entry
4332033           CDS       T01015                                 
Name
(RefSeq) heparanase-like protein 1 isoform X1
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4332033
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:osa00536]
    4332033
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     4332033
Glycosaminoglycan binding proteins [BR:osa00536]
 Heparan sulfate / Heparin
  Enzymes
   4332033
SSDB
Motif
Pfam: Glyco_hydro_79n PHtD_u1
Other DBs
NCBI-GeneID: 4332033
NCBI-ProteinID: XP_015631835
UniProt: Q10Q31 Q0DU24
LinkDB
Position
3:5823520..5828048
AA seq 541 aa
MEVRLLLLVFICLHALLWAASAQQPEEATVIVKGSTKIAETNKNYICATIDWWPPEKCNY
NQCPWGQSSILNLDLDHPFLAQAIQAFDNLRIRLGGSLQDRVVYDVGTNSPCAPFTNMSN
GLFGFSDGCLSMDRWDKLNALFQKTGAIITFGLNALYGRYNVRRSFWASKWNSTNAYNFV
KYTISKGYPVDSWEYGNELSGHGIGARVDATLYGKDAIELKSIFQQLYKAPLSQPSLLAP
GGFFDQQWYTQLLQTSGHGVVSALTHHIYNLGGGNDAHLIRKILDPKYLDRSEDTYRDMQ
LTLQRHGTWASAWVSESGGVFNNGGELVSNTFINSIWYLDQLGMASKYNTKIFCRQTLIG
GHYGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINAPRKLRAYAHCRKQQQGITLLLI
NLSNTTGYNVTLQNDINVSLDKTASLHKHNSFSHSLRRAVSWLGRKPSSDVARREEYHLT
AKDGDLQSKTMLLNGAPLELSDDGGVPAMSPALVAVNSPVYLAPTSIAFVVLPMFEAKAC
S
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggaggtgaggctgctgcttctagtgttcatatgtctgcatgctcttctttgggcggct
tcggctcagcagccagaggaggcgacggtcatagttaagggatcgacaaaaatcgctgaa
acgaataaaaattatatatgtgctacaatcgattggtggccaccagagaagtgtaactat
aatcagtgtccatggggccaatcgtcaattctaaacttggatttggatcatcccttcctg
gctcaagccattcaagcatttgataatttgaggattagactgggaggctctttgcaagac
cgagttgtttatgatgtgggtacaaacagtccatgcgccccgttcacaaacatgtcaaat
ggtttatttggtttctcagatggttgtctaagcatggataggtgggacaaactgaatgct
ctattccaaaaaacaggtgcaattatcacatttggtctgaatgcgctctatgggaggtac
aatgtccgtcgttctttctgggctagcaaatggaactctacaaatgcatataattttgta
aaatacacaatctcaaagggatatccagttgactcatgggaatatggtaatgaactgagc
gggcatggaattggggcaagagtcgatgctacactgtatggaaaagatgcaattgaactt
aaatccatctttcaacagttgtacaaggcaccactctcccagccatccctgttagcccct
ggaggattctttgatcagcagtggtacactcagctacttcagacttctggtcatggcgtt
gtcagtgctttgacgcatcatatttataatcttggtggagggaatgatgcccaccttata
aggaagatattagatccaaagtatttagatcgttcagaagatacttatagggatatgcaa
ctcacccttcaaaggcatggaacatgggcttctgcctgggtcagcgaaagcggaggtgta
ttcaacaatggcggtgaacttgtgtcaaacactttcatcaatagcatctggtatcttgat
cagcttggaatggcatctaagtacaatacaaaaatattctgcaggcagactctgattggt
ggccactatggtctacttgacacccaaacttttttgccaaatcctgattactatagtgct
ctactatggcatcggcttatgggcagggaagttctttcagttgatatcaatgcgccgcgt
aaactgcgtgcttatgctcattgcaggaaacagcagcaaggaatcaccctcctgttgatc
aacctgagcaataccaccggatacaacgtcaccctccagaatgacatcaatgtcagcctt
gacaaaacagccagccttcataagcacaattctttctcacacagcctcagaagagcggtt
tcatggctggggcgcaagccgtcaagcgacgtcgcgaggagggaggagtaccacctgacg
gccaaggacggcgacctccagagcaagacgatgctgctcaacggcgcaccgctggaactc
tcggacgacggcggcgttccggccatgagccctgcgctcgttgctgtcaactcgccggtg
tacctggcaccgacatcgatcgcctttgtagttcttccaatgtttgaggccaaggcctgt
tcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340299
Entry
4340299           CDS       T01015                                 
Name
(RefSeq) heparanase-like protein 3
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4340299
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:osa00536]
    4340299
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     4340299
Glycosaminoglycan binding proteins [BR:osa00536]
 Heparan sulfate / Heparin
  Enzymes
   4340299
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 4340299
NCBI-ProteinID: XP_015641662
LinkDB
Position
6:complement(3924745..3928015)
AA seq 525 aa
MEMRRFLGGLCFLALLRLGGAAEAVVGVAGVDGRRAIAATDEDFVCATMDWWPPDKCDYG
TCSWGLASLLNLDLSNKILLNAIRAFSPLKLRLGGSLQDKLVYGTGDGGGPCAPFVKNTS
EMFGFTQGCLPLHRWDELNAFFQKSGARIVFGLNALNGRVPLPDGSMGGPWDYTNAASLI
RYTASKGYKIHGWELGNELSGSGVGTKVGADQYAADVIALKSLVDTIYQGNPSKPLVLAP
GGFFDAGWFTEVIVKTRPNLLNVVTHHIYNLGPGVDTHLIEKILNPSYLDGMVSTFSNLQ
GILKSAGTSAVAWVGESGGAYNSGRHLVTDSFVFSFWFLDQLGMSAKYDTKSYCRQSLIG
GNYGLLNKETFQPNPDYYSALLWHRLMGTKVLSATFNGTNMIRTYAHCAKDSPGITLLLI
NLSGNTTSQVSVTSEGAHANTVKKHSRKTRHLAAGSMREEYHLTAKDGSLQSQVMLLNGR
ALVADENGEIPRLEPVKVDAAQPIAVAPYSIVFAHIHNFPAPACS
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggagatgaggcggtttcttggtgggctatgcttcttggctctgctgcggctgggcggc
gccgcggaggccgtggtcggggtcgccggcgttgacgggcggcgcgccattgccgccacc
gacgaggacttcgtgtgcgcgacgatggactggtggccgccggacaagtgcgactacggc
acctgcagctggggcctcgcctccctcctcaacctggatctctccaacaaaatcttgctc
aatgccattcgagccttctcgccgttgaagctgcggctgggcgggtcgctgcaggacaag
ctggtgtacggcaccggcgacggcggagggccgtgcgcgccgttcgtcaagaacacgtcg
gagatgttcggcttcacgcagggatgcctgcctctccaccggtgggacgagctcaacgcc
ttcttccaaaaatccggcgcgagaatcgtgttcgggctgaacgctctcaacggccgggtt
ccgttgccggatgggtcgatgggagggccatgggattacaccaatgctgcatcgctgatt
cgttacaccgcgagcaagggttacaaaattcatggatgggagcttggaaatgaactcagt
ggcagtggagttggaacaaaagttggggctgaccaatatgctgcagatgtgattgcactg
aaatcactagttgacactatctaccaaggcaatccatcaaagccacttgttcttgctcct
ggaggtttctttgatgcaggctggtttactgaagttatagtcaaaaccaggccaaaccta
ctgaatgtggtcacccatcacatctacaacttagggccaggagtggacacacatctgatt
gagaagatcctgaatccatcttatcttgatggaatggtgagcacattcagcaatcttcag
gggatactgaaatctgccgggacttcggctgtcgcatgggtcggagagtccggaggcgcg
tacaacagcggccgccatcttgttaccgattcatttgtgttcagtttctggtttttggat
cagcttgggatgtcagcaaagtatgacacgaagagttactgcagacaaagtttgattggt
ggcaactatggcctgctaaacaaagaaacattccaaccaaatcctgactattacagcgct
ctactatggcatcgcctcatgggaaccaaagttctatctgcaacattcaatggcaccaac
atgattcgcacttatgcgcattgcgcaaaagattctccaggaataacactactgctgatc
aacctcagtggcaacaccacaagccaagtttcagtgacaagtgaaggtgctcatgcaaac
actgtgaagaagcatagcagaaagaccaggcatcttgcagctggatcaatgagagaagaa
taccatcttactgccaaagatggcagcttgcagagccaagtgatgctgctgaatggcagg
gcattggttgctgatgaaaatggggaaatccctaggctggagcctgtcaaagtggatgca
gcacagccaatagctgtggctccttactccattgtgtttgctcacatacacaatttccct
gcccctgcatgtagttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343804
Entry
4343804           CDS       T01015                                 
Name
(RefSeq) heparanase-like protein 1
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4343804
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:osa00536]
    4343804
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     4343804
Glycosaminoglycan binding proteins [BR:osa00536]
 Heparan sulfate / Heparin
  Enzymes
   4343804
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 4343804
NCBI-ProteinID: XP_015646298
UniProt: A0A0P0X8Z5 Q6ZJE2
LinkDB
Position
7:complement(24417387..24419567)
AA seq 529 aa
MAAVLPLLAAALLVLFSGLHPAASTAAAGGEAATVVVKAAAAVSRTDDNFVCATLDWWPR
DKCNYGMCPWYNASIINLDLNNTILNNAVKAFNSLRIRLGGSLQDQVTYKVGSNYGDCRS
FQRDDGGLFGFTDGCLEMNRWDELNVFFKRTNTTVTFGLNALKGRRKAAGGKDTLYSGDW
DARNALDLMRYTAGKGYRVESWELGNELSGSGVAARVAAAQYGRDVAVLRKAVERVYGGG
GEVPKVLAPGGFYDGAWFSEMLRVSGRGAVDGVTHHIYNLGSGKDRDLARKMQDPGYLDQ
VEKTFRDMAATVRGSGPWSSPWVGESGGAYNSGGKGVSDRYVNGFWYLDQLGMSAAHGTR
VYCRQALVGGNYCLLNTTTFVPNPDYYGALLWHRLMGPVVLKAATTAGGGGSPYLRSYAH
CSREKPGVTVLLINLSNATAFDVSVAGGALGAAPCGGRREEYHLSPLGGDIRSQVVLLNG
EALALGPGGEIPELRPAVVGDGCAAPLRVAARGIAFVRFTEFKAPACAA
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggccgccgtccttcccttgctcgccgccgccctcctcgtcctcttctccggcctgcat
cccgccgcctccaccgccgccgccggcggcgaggcggccaccgtggttgtcaaggcggcg
gcggccgtctcccgcaccgacgacaacttcgtctgcgcgacgctcgactggtggcccagg
gacaagtgcaactacggcatgtgcccctggtacaacgcctccatcattaacctggatctg
aacaacactattctgaacaatgctgtcaaagcgttcaactcgcttaggattaggctcgga
gggtctcttcaggaccaggtgacgtacaaagtcggcagcaactacggcgattgccggagc
ttccagcgagacgacggcggcctcttcggcttcaccgacggctgccttgaaatgaaccga
tgggacgagctcaacgtcttcttcaaaagaaccaacacgacggtgacgttcgggctgaac
gcgctcaagggccggaggaaggccgccggcggcaaggacacgctgtactccggcgactgg
gacgcccggaacgcgctcgacctgatgcggtacaccgccggcaagggctaccgcgtcgag
tcgtgggagctcggcaacgagctgtccggcagcggcgtcgcggcgagggtggcggcggcg
cagtacggccgcgacgtggcggtgctgaggaaggcggtggagcgtgtgtacggcggcggc
ggcgaggtgccgaaggtgctcgcgccgggcgggttctacgacggcgcgtggttctcggag
atgctgcgggtgtcggggcgcggcgccgtcgacggcgtgacgcaccacatctacaacctc
ggctccggcaaggacagggacctggcgaggaagatgcaggacccggggtacctcgaccag
gtggagaagacgttccgcgacatggcggccacggtgcggggctccgggccgtggagctcg
ccgtgggtgggcgagtccggcggcgcgtacaacagcggcgggaagggcgtgtcggacagg
tacgtgaacggcttctggtacctcgaccagctcggcatgtcggcggcgcacggcaccagg
gtgtactgccgccaggcgctcgtcggcggcaactactgcctcctcaacaccaccaccttc
gtccccaaccccgactactacggcgcgctgctctggcaccgcctcatgggcccggtggtc
ctcaaggcggcgaccaccgccggcggcggaggttcgccgtacctccggtcgtacgcgcac
tgctcgagggagaagccgggggtgacggtgctcctgatcaacctgtcgaacgcgacggcg
ttcgacgtgtcggtggccggcggcgcgctcggcgcggcgccgtgcggcgggcggagggag
gagtaccacctgagcccgctcggcggcgacatccggagccaggtggtgctgctcaacggc
gaggcgctggcgctcggcccgggcggcgagatccccgagctccggccggccgtcgtcggc
gacgggtgcgcggcgccgctgcgcgtggcggcgcgcggcatcgcgttcgttaggttcacg
gaattcaaggctcccgcatgcgcggcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352626
Entry
4352626           CDS       T01015                                 
Name
(RefSeq) heparanase-like protein 1
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00531  Glycosaminoglycan degradation
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4352626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:osa00536]
    4352626
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     4352626
Glycosaminoglycan binding proteins [BR:osa00536]
 Heparan sulfate / Heparin
  Enzymes
   4352626
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 4352626
NCBI-ProteinID: XP_015620710
UniProt: Q2QN56 Q0IMC4
LinkDB
Position
12:23931320..23935710
AA seq 539 aa
MRLWFLIPLLLCFPTLIRSEDYSDVTIVVRGAETIASTSNEFICATIDWWPPEKCNYDQC
PWGQASILNLDLTNPLLAKAIQAFSPLRIRLGGSLQDQVVYGTPNLGSPCTPFSKSSSGL
FGFSQGCITMERWDAINKIFMDTGAVVTFGLNALQGRQQMGRGVWGGAWNSSNAREFMEY
TVSMNYPIDSWEFGNELSGSGIGASVGAEQYGKDIIELKNIISQLYGNSRKPLVVAPGGF
YDQKWYAQLLDISGPNVLDTMTHHIYNLGAGNDPQVANRILNPQYLSQSSDTFRDLQMTI
QRHGPWSAPWVGEAGGAYNSGSRKVSNTFLNSFWYLDQLGQSAKYDTKVYCRQTLIGGNY
GLLDTETFVPNPDYYSALLWHRLMGKGVISLDTSGSSYLRAYAHCGKQKGGVALLMLNLN
KNMGFMVSVRNDLNINFREMAGIKRDNSFVHGLKRTVSWVGSKASDGLEKREEYHLTPQD
GNPFARTVLLNGAPLQLTGDGDIPSLPPVMVSVNSPIYVAPLSIAFVVFPDFEAEGCER
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgaggctatggtttctcatacctcttcttctctgtttccctacattgattcgatccgag
gattactcggatgtgaccatcgtcgttcggggtgctgagacgatcgcttcgaccagcaac
gagttcatttgcgccaccattgattggtggcctccagagaagtgcaattatgaccagtgt
ccatgggggcaagcttctatcttaaatttggacttgactaatcctttgctagctaaagct
atccaagcctttagccctctacgtatcagacttggaggttccttacaagatcaggtggtg
tatggcacgccgaatttaggatctccatgcaccccattttcaaagagttcaagtggcctg
tttggattttctcaaggatgcataaccatggaaagatgggatgctattaataagatcttt
atggatacaggtgcagttgttacattcggccttaacgcgcttcaagggcgacagcagatg
ggcagaggtgtttggggaggtgcttggaattccagtaatgctcgggagttcatggagtac
actgtttcgatgaactaccctatagactcatgggaatttggtaatgagttgagtggaagt
ggaattggtgcaagtgttggagctgaacaatatggaaaagatataattgagctcaagaac
atcatcagccagttatatggaaactctaggaaaccattggtggttgccccaggaggattc
tatgaccaaaaatggtatgctcagcttcttgatatctctggtccaaatgttctcgacaca
atgactcatcatatttacaatcttggtgctggtaacgatccgcaagttgcaaataggatc
ttgaatccgcagtatttgagccagagctctgatacattcagagatctccaaatgacgata
cagcggcatggaccatggtctgctccctgggttggggaagctggtggtgcatataacagt
ggcagccgaaaagtgtctaatactttcctgaatagcttctggtatcttgatcagcttggt
cagtcagcaaagtatgacacaaaggtttactgcagacagactttgattggaggcaactat
ggccttcttgataccgaaacttttgttccaaaccctgattactacagtgccttgctgtgg
catcggctcatggggaagggagttatttccttagacaccagcggttcttcgtacttgcgt
gcctatgcgcattgcggaaagcaaaagggcggcgtcgcgctcctcatgctcaacctgaac
aagaacatgggattcatggtctcagtcagaaatgacctcaacattaatttcagagaaatg
gcagggataaagagggacaactcctttgtccatggcctgaagaggacagtctcctgggtt
gggagcaaagcctcggatgggctggagaagagggaggagtaccatctgactccacaggat
ggcaacccttttgccaggacagtgctgctcaatggagctcctcttcagctcactggagat
ggtgacatcccttcactgccaccagtgatggtctcagtcaattccccaatctatgtcgcc
ccgctgtcgatcgcgttcgtcgtcttcccagatttcgaggctgaaggttgcgaacgatga

DBGET integrated database retrieval system