KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331045
Entry
4331045           CDS       T01015                                 
Name
(RefSeq) probable monogalactosyldiacylglycerol synthase 3, chloroplastic
  KO
K03715  1,2-diacylglycerol 3-beta-galactosyltransferase [EC:2.4.1.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4331045
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4331045
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.46  monogalactosyldiacylglycerol synthase
     4331045
Glycosyltransferases [BR:osa01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   4331045
SSDB
Motif
Pfam: MGDG_synth Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-GeneID: 4331045
NCBI-ProteinID: XP_015627712
LinkDB
Position
2:34223117..34227486
AA seq 508 aa
MAASSSSSSSMASPRGRSIRETVLETVAAYHQQQRMRRKFRKSLSYAGELSSAGRARGEG
GASSSASTTSLCGPDEDDEPFWEEEEGTVELVQLGANRAKNVLILMSDTGGGHRASAEAI
KDAFRIEFGDDYRVFVKDLCKDHAGWPLNNMESSYKFMVKHVQLWKVAFHTTSPRWVHCF
YLAALASFYAKKVEAGLKKYKPDIIISVHPLMQHIPLWVLKWQGLQNRVVFVTVITDLNT
CHPTWFHADVNRCYCPSEEVAKRAALDDLQPSQIRVFGLPIRPSFCRAVLVKDDLRKELE
LDPELPAVLLMGGGEGMGPVKKTAKALGESLFDKELGKPIGQLIVICGRNKTLSSSLQAL
EWKIPIKVRGFETQMEKWMGACDCIITKAGPGTIAEALIRGLPIILNDFIPGQEVGNVPY
VVDNGAGVFSKSSRETAKLVARWFGPDSDELKRMSEKALKLAQPEAVFDIVRDIHELSRE
QGVISQISSSLTSSFFIPSPETTPIQLM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggcggcgtcgtcgtcgtcgtcgtcgtcgatggcgtcgccgagggggaggtcgatccgg
gagacggtgctggagacggtggcggcgtaccaccagcagcagaggatgaggcgcaagttc
aggaagagcctctcctacgcgggggagctgtcgtcggcggggcgcgcgcgaggggagggc
ggggcgtcctcgtcggcgtccaccacctcgctgtgtggccccgacgaggacgacgagccc
ttctgggaggaggaggagggcaccgtcgagctcgtccagctcggcgccaaccgggctaag
aacgtgctcatcctcatgagcgacaccggcggcggccaccgcgcctccgccgaggctatc
aaggacgccttccgcatcgagttcggcgacgattaccgggtcttcgtcaaggatctgtgc
aaggatcacgcggggtggccgctgaacaacatggagagctcgtacaagttcatggtgaag
catgtgcagctatggaaggtggccttccacaccacatcgccgagatgggtccattgcttc
tacctcgccgcgctcgcctcattctatgccaagaaggttgaggctggactcaagaagtac
aaaccagatattataattagtgtccaccccctcatgcaacacattcctctatgggtactc
aaatggcaagggctacaaaatagagtggtctttgtcactgtcatcacagacctcaacact
tgtcaccctacatggttccatgctgatgtcaatagatgttactgcccatcggaagaagtt
gccaagagagcagcactggatgacctacaaccttctcaaatccgtgtgtttggccttccg
attcggccatcattctgccgagccgttcttgttaaggatgatttgaggaaggaacttgaa
ttggatcctgagctgcctgcagtattgctgatgggaggtggagagggcatgggtcctgtc
aagaagaccgcaaaagcccttggagagtcgttgtttgacaaggagcttggaaaaccaatt
ggacagttaattgtcatttgtggtcggaacaaaacgctgagctcctcattgcaggctctt
gaatggaaaataccaattaaggttaggggatttgagacccagatggagaaatggatgggg
gcttgtgattgcattataacaaaggctggaccaggtaccatcgccgaagccttgattaga
gggttgcctatcatccttaatgacttcatacctggacaggaagttggcaatgtcccttat
gttgtggacaatggtgctggtgtcttctccaaaagttctagggaaactgctaaacttgtt
gcccgctggtttggtccagattctgatgaactgaagaggatgtcagaaaaagcgttaaaa
ctggctcagccagaagcggtgtttgatattgtcagagacatccatgagctatctcgggag
caaggggtgatttcacagatatccagttccttgacatcatcctttttcataccatcgcca
gaaaccacacctatacaacttatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345212
Entry
4345212           CDS       T01015                                 
Name
(RefSeq) probable monogalactosyldiacylglycerol synthase 2, chloroplastic isoform X1
  KO
K03715  1,2-diacylglycerol 3-beta-galactosyltransferase [EC:2.4.1.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4345212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4345212
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.46  monogalactosyldiacylglycerol synthase
     4345212
Glycosyltransferases [BR:osa01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   4345212
SSDB
Motif
Pfam: MGDG_synth Glyco_tran_28_C Glyco_trans_1_4 Glyco_transf_4
Other DBs
NCBI-GeneID: 4345212
NCBI-ProteinID: XP_015649135
UniProt: Q6UTZ2 B9G069
LinkDB
Position
8:12265792..12269818
AA seq 469 aa
MVISVATPRRSIRDAVLGGVLGAGGRQLYQPLRCAFYDGAAGGGLTAALSEDGAEGGVPL
PCGRKTAAAKNVLILMSDTGGGHRASAEALRDAFRLEFGDAYQVFVRDLGKEYGGWPLND
MERSYKFMIRHVRLWKVAFHGTSPRWVHGMYLAALAYFYANEVVAGIMRYNPDIIISVHP
LMQHIPLWVLKWQSLHPKVPFVTVITDLNTCHPTWFHHGVTRCYCPSAEVAKRALLRGLE
PSQIRVYGLPIRPSFCRAVLDKDELRKELDMDPDLPAVLLMGGGEGMGPVEETARALSDE
LYDRRRRRPVGQIVVICGRNQVLRSTLQSSRWNVPVKIRGFEKQMEKWMGACDCIITKAG
PGTIAEALIRGLPIILNDFIPGQEVGNVPYVVDNGAGVFSKDPREAARQVARWFTTHTNE
LRRYSLNALKLAQPEAVFDIVKDIHKLQQQPATVTRIPYSLTSSFSYSI
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggtgatctcggtcgccaccccccgccgctccatccgcgacgccgtgctgggtggcgtg
ctcggcgccggaggccgccagctctaccagcccctccgctgcgccttctacgacggcgcc
gccgggggcggcctcaccgccgcgctctcggaggatggagccgagggcggcgtccccctc
ccgtgcgggaggaagacggcggcggcgaagaacgtgctcatcctcatgagcgacaccggc
ggcggccaccgcgcatccgccgaggccctccgcgacgccttccgcctcgagttcggcgac
gcctaccaggtgttcgtgagagatttggggaaggagtacggcgggtggccactgaacgac
atggagcggtcgtacaagttcatgatccgccatgtccggctctggaaggtggcgttccac
ggcacttcgccgcgctgggtgcacggcatgtacctcgccgcgctggcctatttctacgcc
aacgaggtggtggccgggatcatgaggtacaaccccgacattatcatcagcgtgcacccg
ctgatgcagcacatcccgctgtgggtgctcaagtggcagagcctccaccccaaggtgcca
ttcgtcaccgtcatcaccgacctcaacacctgccacccgacatggttccaccatggcgtg
acgaggtgctactgcccgtcggcggaggtggccaagagggcactgctccgggggctcgag
ccgtcccaaatccgtgtgtacgggttgccgatcaggccgtccttctgccgcgccgtgctc
gacaaggatgagctgaggaaagagctggacatggatcccgacctgcctgcagtgctactg
atgggcggcggcgaggggatgggtccggtggaggagacggcgagagcactcagcgacgag
ctctacgatcgccggagacgccggcctgtcgggcagatcgttgtcatctgtggcaggaac
caggtgctgcggtccacgctgcagtcgtcacggtggaatgtccctgtcaagattagaggg
ttcgaaaagcagatggagaagtggatgggcgcttgcgattgcatcatcacaaaggctggt
cctggtacaattgcagaggccctgataagaggactcccaattattctcaacgacttcata
cctggacaggaagtcgggaatgtgccttacgtcgtggacaatggtgccggtgtgttctcc
aaggacccgagggaagccgcgagacaggttgccagatggttcaccacacacacaaacgag
ctccggagatactccctcaacgcgctgaagctagcgcagccagaagccgtgttcgacatc
gtgaaggacatccacaagctccagcagcagcctgccacggtgacgcggatcccttactcc
ctgacctcatcgttctcatacagcatatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347099
Entry
4347099           CDS       T01015                                 
Name
(RefSeq) probable monogalactosyldiacylglycerol synthase 1, chloroplastic
  KO
K03715  1,2-diacylglycerol 3-beta-galactosyltransferase [EC:2.4.1.46]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00561  Glycerolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4347099
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4347099
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.46  monogalactosyldiacylglycerol synthase
     4347099
Glycosyltransferases [BR:osa01003]
 Glycolipid biosynthesis
  Glycoglycerolipid
   4347099
SSDB
Motif
Pfam: MGDG_synth Glyco_tran_28_C Glycos_transf_1 Glyco_trans_1_4
Other DBs
NCBI-GeneID: 4347099
NCBI-ProteinID: XP_015611851
UniProt: Q69QJ7
LinkDB
Position
9:complement(15349030..15355642)
AA seq 535 aa
MPAPTASSLAAAADPALPAAFLSLPSPLLPASPPLPAAPAPSSNAFCVPRGPARAVAVSV
SVSAYGAGSTAAASRLHRMWAEFSRFVRLHGNQIAPLGFASLGLGVGGGGGGSGEGAGGG
GGGGGGEVDGLVEEEGVARAEAPKKVLILMSDTGGGHRASAEAIKAAFIQEFGDDYQVFV
TDLWTDHTPWPFNQLPRSYSFLVKHGPLWKMTYYGTAPRVVHQPHFAATSTFIAREVAKG
LMKYQPDVIISVHPLMQHVPLRILRSKGLLDKIPFTTVVTDLSTCHPTWFHKLVTRCYCP
SAEVSKRALKAGLQPSQIKVYGLPVRPSFVKPIRPEDELRRELGMDEYLPAVLLMGGGEG
MGPIEATARALGDALYDEVLGEPTGQILVICGRNKKLTSRLQSINWKVPVQVKGFVTKME
ECMGACDCIITKAGPGTIAEAMIRGLPIILNGYIAGQEAGNVPYVVDNGCGKFSKSPEQI
AKIVADWFGPRSDELKMMSQNALKLARPDAVFKIVHDLHELVRQKCFVPQYACAS
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgccggcgccgaccgcctcgtcgctggccgccgcggcggaccctgcgctccccgccgcg
ttcctctcgctcccgtccccgctcctcccggcctcccctcccctccccgcggcccccgcc
ccctcctccaacgccttctgcgtcccccgcggccccgcccgcgcggtcgccgtctccgta
tccgtctcggcctacggcgcgggctccaccgccgcggcgtcgcggctccaccggatgtgg
gccgagttctcccgcttcgtgcggctgcacgggaaccaaatcgcgccgctcgggttcgcg
tccctcggcctgggcgttggaggcggcggcggtgggagcggcgaaggggccggcggggga
ggcgggggcggaggtggggaggtggatgggttggttgaggaggaaggggtggcgcgggcc
gaggcgccgaagaaggtgctgatcctgatgagcgacacgggcggcgggcaccgcgcttcc
gccgaggccatcaaggcggcgttcatccaggagttcggcgacgactaccaggtattcgtc
actgatttatggactgaccataccccatggccattcaaccaactacccaggagctacagt
ttcttggtgaaacatggacccttgtggaagatgacatactatggtactgcaccacgagta
gttcatcagccacattttgctgcaacatcgacattcatagcaagagaggttgcaaaaggt
ctcatgaaataccaaccagatgtaattatcagtgtccatcctttaatgcagcatgtccca
ctccgaatcctaaggtcaaaaggtttactggataagattccgttcacaacagttgtcaca
gatctgagtacttgtcacccaacatggtttcacaagcttgttactagatgttactgtcca
tcagctgaagtgtcaaagagagcactaaaagctggattgcagccctcgcaaattaaagtc
tatggcctcccagtacgtccatcttttgtcaaacctattcgaccagaggatgaactgcga
agggagttaggtatggatgaatatttgcctgctgttctactaatgggtgggggggaaggg
atgggtcctattgaagccactgctagagcacttggtgatgctctatatgacgaagtcctt
ggtgaacccactggtcaaatacttgtgatttgtggccgtaataagaagctgactagccga
ttgcagtcaatcaattggaaagttccagttcaggttaagggtttcgttacaaagatggaa
gaatgcatgggtgcttgtgactgtataattacaaaggcggggcctggtacaattgcagag
gccatgattcgtggcctgcccattatactaaatggatatattgctggtcaggaagctggc
aatgttccatatgttgttgataatggatgtgggaagttctcaaaatctccagaacaaatt
gcaaagattgtagccgattggtttggccctaggtcagacgagctcaaaatgatgtctcaa
aatgccttgaaactagcgcgaccggatgcagtgtttaaaattgtccacgatctgcatgag
ttagtcaggcaaaaatgttttgtaccccaatatgcgtgtgcatcataa

DBGET integrated database retrieval system