KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331122
Entry
4331122           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L23
  KO
K02894  large subunit ribosomal protein L23e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331122
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331122
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4331122
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-GeneID: 4331122
NCBI-ProteinID: XP_015625817
UniProt: A0A0P0XVK3 Q9AV77
LinkDB
Position
2:34910958..34913464
AA seq 140 aa
MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP
IGKECADLWPRIASAANAIV
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtcgaagcgagggcgtggaggtagtgctggtaacaagttccggatgtcactgggtctg
ccagtggcagccactgtgaactgtgctgacaacactggagcaaagaacctttacatcatt
tctgtgaagggaatcaagggacgccttaacaggcttccttctgcttgtgttggggacatg
gttatggctactgtgaaaaaagggaagcctgacctgaggaagaaggtcatgccagctgtc
atcgtgaggcagcgcaagccgtggcgccgaaaggatggtgtctacatgtactttgaagac
aatgctggagtcattgtgaaccccaagggagagatgaaaggttctgccatcactggacct
atcggaaaggagtgcgctgatctctggcccaggattgcaagtgcagcaaatgcgatcgtc
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331562
Entry
4331562           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L23
  KO
K02894  large subunit ribosomal protein L23e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331562
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331562
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4331562
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-GeneID: 4331562
NCBI-ProteinID: XP_015630792
UniProt: A0A0P0XVK3 Q9AV77
LinkDB
Position
3:2142625..2145410
AA seq 140 aa
MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP
IGKECADLWPRIASAANAIV
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtcgaagcgagggaggggagggtcggcggggaacaagttccggatgtcgctgggtctg
cctgtggcggcgacggtgaactgcgcggacaacaccggggccaagaacctctacatcatc
tccgtgaagggcatcaagggccgcctcaaccgcctcccgtccgcctgcgtcggcgacatg
gtcatggccaccgtcaagaagggcaagcccgatctccgtaagaaggtcatgcccgccgtc
atcgtccgccagcgcaagccgtggcgccgcaaggacggtgtctacatgtacttcgaagat
aatgctggagtgattgtgaatcctaagggtgagatgaaaggttctgctatcactggaccc
atcgggaaggagtgtgctgacctttggcctaggatagctagtgcagcaaatgctattgtc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348846
Entry
4348846           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L23
  KO
K02894  large subunit ribosomal protein L23e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348846
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348846
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4348846
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-GeneID: 4348846
NCBI-ProteinID: XP_015614943
UniProt: A0A0P0XVK3 Q9AV77
LinkDB
Position
10:complement(17227370..17229425)
AA seq 140 aa
MSKRGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDM
VMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVYMYFEDNAGVIVNPKGEMKGSAITGP
IGKECADLWPRIASAANAIV
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtcgaagcgagggaggggtgggtcggcggggaacaagttccggatgtcgctgggtctg
ccggtggcggcgacggtgaactgcgccgacaacaccggcgccaagaacctctacatcatc
tccgtgaagggcatcaaggggaggctcaaccggctgccgtcggcctgcgtcggcgacatg
gtcatggccaccgtcaagaaggggaagcccgacctccggaagaaggtcatgcccgccgtc
atcgtccgccagcgcaagccgtggcgccgcaaggacggcgtctacatgtacttcgaagac
aatgctggggtgattgtgaatcccaagggtgagatgaaaggttctgctatcactggaccc
attggtaaggagtgcgccgacctctggccaaggattgctagcgcagcaaatgccattgtc
tag

DBGET integrated database retrieval system