KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331152
Entry
4331152           CDS       T01015                                 
Name
(RefSeq) protein LUTEIN DEFICIENT 5, chloroplastic
  KO
K15747  beta-ring hydroxylase [EC:1.14.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    4331152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4331152
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     4331152
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP97 family
   4331152
SSDB
Motif
Pfam: p450 DUF6285
Other DBs
NCBI-GeneID: 4331152
NCBI-ProteinID: XP_015626020
UniProt: Q0DWE8 A0A0N7KGC0
LinkDB
Position
2:complement(35092407..35100766)
AA seq 643 aa
MSSATSVSAFAMAATSSAAAAAPPPCRLLGSGQAHLRLPPSAAAAAASARRRLLLRCAAS
GGNGKGGGGDGSGSDPVLEERRRRRQAELAARIASGEFTAQGPAWIAPLAVGLAKLGPPG
ELAAALLTKVAGGGGPEIPQAVGSMSAVTGQAFFIPLYDLFLTYGGIFRLNFGPKSFLIV
SDPAIAKHILRDNSKAYSKGILAEILEFVMGTGLIPADGEIWRVRRRAIVPAMHQKYVTA
MISLFGYASDRLCQKLDKAATDGEDVEMESLFSRLTLDVIGKAVFNYDFDSLSYDNGIVE
AVYVTLREAEMRSTSPIPTWEIPIWKDISPRQKKVNEALALINKTLDELIDICKRLVEEE
DLQFHEEYMNEQDPSILHFLLASGDDVSSKQLRDDLMTMLIAGHETSAAVLTWTFYLLSK
YPNVMAKLQDEADTVLGDRLPTIEDVKKLKYTTRVINESLRLYPQPPVLIRRSIEEDMLG
GYPIGRGEDIFISVWNLHHCPKHWDGADVFNPERWPLDGPNPNETNQNFSYLPFGGGPRK
CVGDMFATFETVVATAMLVRRFDFQMAPGAPPVEMTTGATIHTTEGLKMTVTRRTKPPVI
PNLEMKVISDSPENMSTTTSMPVSAASIASGEDQQGQVSATRI
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgagctcagcgacgtcagtgagtgcctttgccatggcggctacctcctctgcggccgcc
gctgctccacctccgtgccgcttactcggctccggtcaggcacacctgcgccttcctcct
tctgctgctgctgctgctgcttcagctcgtcgccgcctgctcctccgctgcgccgcctcg
ggcggcaacgggaaaggcggtggtggcgacggctccggctccgacccggttcttgaggag
cggcggcggcggcgccaggctgagctggcggcgcgcattgcgtccggcgagttcaccgcc
caaggccccgcgtggattgctcccctcgcggtggggcttgccaagctcggcccaccgggg
gagctcgccgccgcgctgctcaccaaggtcgccggtggcggcggaccggagataccgcag
gcggtggggtctatgagtgcggtgacagggcaggctttcttcatcccgctctatgatctc
ttccttacctatggcggcatctttcgcctcaatttcggccctaagtctttcctcattgtc
tctgatccagctatagctaagcacatcctgagggacaactccaaggcttattccaagggt
attctggcagaaattttagagtttgtgatgggtacgggtttgatccctgctgatggggag
atttggcgtgttaggaggcgcgccattgtaccagcaatgcaccagaagtacgttaccgca
atgataagtctcttcggatatgcttcagatcggctctgccagaagttggacaaggcagca
acggatggggaggatgtggagatggaatctttgttctctcgactaacactggatgtcatt
gggaaggcagtcttcaattatgatttcgactcattgtcttacgataatggaatagttgag
gcagtgtatgtgacactgcgagaagcagaaatgcggagcacttctcctataccaacttgg
gaaatacccatatggaaagatatttccccgcggcagaagaaggtcaatgaagctcttgcg
ctgataaataagactcttgatgaactaattgacatctgcaagagattggtcgaggaagaa
gatctgcagtttcatgaagaatacatgaatgagcaagaccccagtatcctccactttctt
ttggcatctggagatgatgtctccagcaagcaactccgtgatgatctgatgacaatgctc
attgctggccatgagacctctgcagcagtcttgacatggacattttatcttctatctaag
tatccaaatgtaatggccaaactccaagatgaggctgatactgttctaggtgaccgttta
ccaacaattgaggatgtgaagaaattgaagtatactactagagtaattaacgaatcattg
agactctatccacagccaccagttttaattcgtcgctctattgaggaggatatgctggga
gggtacccaattggccggggagaagacattttcatatccgtgtggaacctacatcattgc
ccaaagcattgggatggtgcagatgtttttaatccagaaagatggcctttggatggacca
aatccaaatgaaacaaaccaaaatttcagttacttgccatttggtggcggaccaaggaaa
tgtgtaggtgacatgtttgccactttcgagactgtggtggcaactgcaatgcttgtcagg
cgctttgattttcaaatggctccaggagctcctccggttgagatgacaactggagcaacg
attcacacaactgaggggttgaaaatgactgttactcggaggacaaagccacctgtaatc
ccaaacctagagatgaaagtcatttctgattcaccagaaaacatgagtactactacatca
atgcccgtttctgctgctagtattgcttcaggagaagatcaacaagggcaagtctcagca
actcgaatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331460
Entry
4331460           CDS       T01015                                 
Name
(RefSeq) beta-carotene hydroxylase 2, chloroplastic
  KO
K15746  beta-carotene 3-hydroxylase [EC:1.14.15.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    4331460
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.24  beta-carotene 3-hydroxylase
     4331460
SSDB
Motif
Pfam: FA_hydroxylase HGTP_anticodon
Other DBs
NCBI-GeneID: 4331460
NCBI-ProteinID: XP_015628773
UniProt: Q10SE7
LinkDB
Position
3:complement(1436315..1439223)
AA seq 285 aa
MAVARLVAARAPLLSPAAVAAAHRSPPALLRLAFAPLPARRLAVPLRVAVGEPEPEEDAR
RAVAERAARKQSERRTYLVAAVMSSLGITSMAAAAVYYRFAWQMEGSGEIPVTEMFGTFA
LSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAITNAVPAMSLLAY
GFFTRGLVPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIANVPYFRRVAAAHQIHH
MDKFEGVPYGLFLGPKELEEVGGIEELEKEIKRRIKRKETLDAIQ
NT seq 858 nt   +upstreamnt  +downstreamnt
atggccgtcgcgaggctggtggccgcgcgggcccctctcctctcccccgccgcggtggcg
gcggcacaccgatcgcccccggcgctgctgcggctggcgttcgcgccgctcccggcgcgg
cggctggccgtccccttgcgcgtggcggtgggtgagccggagccggaggaggatgcgcgg
agggcggtggcggagcgcgcggcgcggaagcagtcggagcggcggacgtacctggtggca
gcggtgatgtccagcctcgggatcacgtccatggccgccgccgccgtctactaccgcttc
gcctggcaaatggagggcagcggcgagatcccggtcacggaaatgttcggcaccttcgcg
ctatcggtgggcgccgcggtggggatggagttctgggcgcggtgggcgcaccgggcgctg
tggcacgcgtcgctgtggcacatgcacgagtcgcaccaccgcccgcgagacgggccgttc
gagctcaacgacgtcttcgccatcaccaacgccgtcccggccatgtccctcctcgcctac
ggcttcttcacccgcggcctcgtccccggcctctgcttcggcgcgggactcgggatcacg
ctgttcgggatggcgtacatgttcgtccacgacggcctggtccaccgccgcttcccggtg
gggcccatcgccaacgtgccctacttccggcgggtcgccgccgcccaccagatacatcac
atggacaagttcgaaggtgtgccatatgggctgttccttggtcccaaggagctggaggag
gtgggtgggattgaggagctggagaaggagatcaagaggaggattaagaggaaagagacc
ttagatgcgatccaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336753
Entry
4336753           CDS       T01015                                 
Name
(RefSeq) beta-carotene hydroxylase 2, chloroplastic
  KO
K15746  beta-carotene 3-hydroxylase [EC:1.14.15.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    4336753
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.24  beta-carotene 3-hydroxylase
     4336753
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-GeneID: 4336753
NCBI-ProteinID: XP_015634148
UniProt: Q0JAT3 Q7XQ82
LinkDB
Position
4:29157215..29159263
AA seq 309 aa
MATGLSGGAMTSFAVKKPLLAAAVRRRSWPPPSGRALPFSPLTRTPRSRGLGTVTCFVPQ
GTESQQAPAPSPPPTVPVPVPSLEEEAAAAAARRIAERKARKLSERRTYLVAAVMSSLGF
TSMAVAAVYYRFHWQLEGGDVPMTEMFGTFALSVGAAVGMEFWAQWAHRSLWHASLWHMH
ESHHRAREGPFELNDVFAITNAVPAISLLAYGFFHRGIVPGLCFGAGLGITLFGMAYMFV
HDGLVHRRFPVGPIANVPYFRRVAAAHKIHHTDKFEGVPYGLFLGPKELEEVGGLEELEK
ELARINRSL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggccaccggtctctccggcggcgctatgaccagcttcgccgtcaagaagccgctcctc
gcggccgccgtgcgccgccggtcgtggcccccgccgtcgggccgcgcgctgccgttctcg
ccgctcacgcggaccccgcgcagccgcgggctcgggaccgtcacgtgcttcgtgccgcag
ggcacggagagccagcaggccccggctccgtccccgccgccgacggtgcccgtgcccgtg
ccctcgctggaggaagaggcggctgccgcggcggcgcggcgcatcgcggagaggaaggcg
cggaagctgtcggagaggcggacgtacctggttgcggccgtcatgtccagcctcggcttc
acgtccatggccgtcgccgccgtgtactaccgcttccattggcaactggagggcggggat
gtgccgatgaccgagatgtttggcacgtttgcgctctccgtcggcgcagcggttgggatg
gagttctgggcgcagtgggcgcaccgctcgctgtggcacgcctccctgtggcacatgcac
gagtcgcaccaccgtgcgcgcgagggcccgttcgagctcaacgacgtgttcgccatcacc
aacgccgtgccggccatctccctcctcgcctacggcttcttccaccggggcatcgtcccc
ggcctctgcttcggcgcgggcctcgggattacgctgttcggcatggcctacatgttcgtc
cacgacggcctggtccaccgccgcttccccgtcggccccatcgcgaatgtgccctacttc
cggcgagtggccgcggcccacaagatacaccacacggacaagttcgagggcgtaccgtat
gggctgtttcttggacccaaggagctggaggaggttggtggtctggaagagctggagaag
gagcttgcgagaatcaaccggagcttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349224
Entry
4349224           CDS       T01015                                 
Name
(RefSeq) beta-carotene hydroxylase 2, chloroplastic
  KO
K15746  beta-carotene 3-hydroxylase [EC:1.14.15.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00906  Carotenoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    4349224
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.24  beta-carotene 3-hydroxylase
     4349224
SSDB
Motif
Pfam: FA_hydroxylase
Other DBs
NCBI-GeneID: 4349224
NCBI-ProteinID: XP_015613806
UniProt: Q8LN34 A0A0P0XWX3
LinkDB
Position
10:20744410..20746553
AA seq 292 aa
MAVARLVVITPAVLLGRTARVSPSAVPRLRPIVAGRRAVAAPTRAVLGDGAGVGGEEDAV
VAVVEEDAVARRAARKRSERRTYLVAAVMSSLGFTSMAAAAVYYRFAWQMEAGGGDVPAT
EMVGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPRDGPFELNDVFAIANAAP
AISLLAYGLLNRGLLPGLCFGAGLGITLFGMAYMFVHDGLVHRRFPVGPIENVPYFRRVA
AAHQIHHTDKFEGVPYGLFLGPKELEEVGGTEELDKEIKKRIKRKEAMDAIR
NT seq 879 nt   +upstreamnt  +downstreamnt
atggccgtcgcgaggctggtggtcatcacccccgccgtcctcctcggccgcaccgcccgc
gtctcgccgtcggcggtgccgcggctgcggcccatcgtcgccggccgccgcgccgtggcg
gcgcccacacgcgccgtcctgggagacggggcgggtgtcggcggcgaggaggatgcggtg
gtggcggtggtggaggaggacgcggtcgcccggcgcgcggcgaggaagcggtcggagcgg
cgcacgtacctggtggcggcggtgatgtccagcctcgggttcacgtccatggccgccgcc
gccgtctactaccgcttcgcctggcaaatggaggccggcggcggcgacgttccggcgacg
gagatggtcggcacgttcgcgttgtcggtgggggcggcggtggggatggagttctgggcg
cggtgggcgcaccgggcgctgtggcacgcgtcgctgtggcacatgcacgagtcgcaccac
cgcccgcgcgacggcccgttcgagctcaacgacgtcttcgccatcgccaacgccgccccg
gccatctccctcctcgcctacggcctcctcaaccgcggcctcctccccggcctctgcttc
ggcgcggggcttgggattacgctgttcgggatggcgtacatgttcgtccacgacggcctg
gtccaccggcgcttccccgtggggcccatcgagaacgtgccctacttccgccgagttgct
gccgcccaccagatacatcacacggacaagttcgaaggcgtgccctacggcctgttcctc
ggacccaaggagttggaggaggtgggtgggactgaggagctggacaaggagatcaagaag
aggatcaagaggaaggaggccatggacgccatcagatga

DBGET integrated database retrieval system