KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331172
Entry
4331172           CDS       T01015                                 
Name
(RefSeq) bet1-like SNARE 1-1 isoform X1
  KO
K08504  blocked early in transport 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4331172
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331172
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    4331172
SSDB
Motif
Pfam: SNARE MafB Latarcin
Other DBs
NCBI-GeneID: 4331172
NCBI-ProteinID: XP_015626198
UniProt: Q6K710 Q6KA19
LinkDB
Position
2:35234131..35238015
AA seq 122 aa
MNSRSNYRSTRTSLFDGIEEGRIRATSYSSHEIDENENDQAIDGLQDRVSILKRLSGDIH
EEVETHNRMLDRMGNDMDSSRGFLSGTVDKFKMVFETKSSRRMGTLVASFVALFLLVYYL
TR
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaactcgagaagcaactaccgcagcaccagaacttctctttttgatggcattgaggag
ggcagaatccgtgcaacatcctattcttcacatgagatagatgagaatgagaatgatcaa
gctattgatggattgcaggatcgagtcagcattctcaagcggttgtctggtgatatccat
gaagaggtggaaactcataaccgtatgctagaccgaatgggcaatgatatggattcgtca
aggggttttctgtctggaacagtggacaagttcaagatggtttttgagaccaaatcaagt
cggaggatgggaaccctcgtagcatcattcgttgcgctttttctgctggtatactacttg
accaggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346340
Entry
4346340           CDS       T01015                                 
Name
(RefSeq) bet1-like SNARE 1-1
  KO
K08504  blocked early in transport 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4346340
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4346340
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    4346340
SSDB
Motif
Pfam: SNARE MafB
Other DBs
NCBI-GeneID: 4346340
NCBI-ProteinID: XP_015648254
UniProt: A3BVT7 Q6ZBW9
LinkDB
Position
8:complement(28208730..28211715)
AA seq 121 aa
MNSRRDFRSHRAALFDGIEEGAIRSSAYSSQIHEHENDQAMDSLHDRVSVLKRLTGDIHE
EVENHNRMLDRMGNDMDASRGFLSGTVDKFKMVFETKASRRMATMVASFISVFFLIYYLT
K
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaactctaggagggacttccgcagccacagagctgctttatttgatggtattgaggag
ggtgcgatcagaagttcagcttactcttctcaaattcatgagcatgagaatgaccaagct
atggacagtctgcatgacagggtcagcgttctcaaaagattgacaggagatatacatgaa
gaagtggagaatcataaccgaatgctggacagaatgggtaatgatatggatgcttccaga
ggatttctatctggaacggtggacaagtttaagatggtttttgagaccaaagcaagtcgc
agaatggctaccatggtggcttctttcatttctgtcttcttccttatatactacctaacc
aagtag

DBGET integrated database retrieval system