KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331188
Entry
4331188           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 9
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4331188
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4331188
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4331188
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4331188
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     4331188
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4331188
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    4331188
 Endosome - Golgi transport
  Others
   Others
    4331188
SSDB
Motif
Pfam: PIP5K MORN
Other DBs
NCBI-GeneID: 4331188
NCBI-ProteinID: XP_015624688
UniProt: Q6KA01 A3ACT5
LinkDB
Position
2:complement(35307399..35313631)
AA seq 824 aa
MTAPAVLPNELEGISRSQRVELFRDASCNIEKEVLSSLANGQDSHASGTNPGFRVGEIRL
SNRDIYFGTLLGNTPEGSGRYVWSDGCTYDGEWRRGMRHGQGKTMWPSGATYEGEYSGGY
IYGEGTYTGSDNIVYKGRWKLNRKHGLGCQTYPNGDMFDGSWIQGEIEGHGKYTWANGNT
YVGNMKNGKMSGKGTLTWKNGDSYEGNWLDGMMHGYGIYTWNECGYYVGTWTKGLKDGKG
TFYPKGCRVPVNDELYINNLRNRGVLPDIRRQNHGSRILHSSSVDMGNMKVGLTRESSGP
SSRRNSSEQPHSKNVSLERRWSLEVAIEKFIGHDATGSSGLERSESINDSDLPMLEREYM
QGVLISEVVLDRSFSDSSKKAKRRQKKIVRETKKPGETIIKGHRSYDLMLSLQLGIRYTV
GKITPIQKREVRASDFGPRASFWMTFPKEGSRLTPSHPAEDFKWKDYCPMVFRNLREMFK
IDAADYMISICGNSALRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVQVLLRMLPKYYHH
VRTYENTLITKFFGLHRVKPSSGQKFRFVVMGNMFCTELRIHRRFDLKGSSLGRSTDKIE
IDENTTLKDLDLNYSFYLEPSWREALLKQIETDSEFLRTQRIMDYSLLLGVHYRAPQHLR
TRASYHRSMAADRLTVLSEEDAQEDDAFNYPEGLVLVQRGGDENSVVVGPHIRGSRLRST
AAGFAEVDLLLPGTARLQIQLGVNMPARAEQNPKEEESKSFREVYDVVLYLGIIDILQEY
NMSKKIEHAVKSMQYDSISISAVDPQFYSERFLKFIQTVFPENS
NT seq 2475 nt   +upstreamnt  +downstreamnt
atgacagcccctgcagtccttccaaatgagttagaagggatctcccgttctcaaagagta
gagctgttccgagacgctagttgcaatatcgaaaaggaggtactgtccagtttagcaaat
ggccaagattctcatgcttctggaacaaaccctggcttcagagttggagagatcaggctc
tccaacagggatatttatttcggcacattattggggaacacaccagagggttcagggagg
tatgtctggtcagatggttgcacttacgatggtgagtggaggagagggatgaggcatggg
caaggaaagacaatgtggccatctggagccacctacgagggtgagtactctggtggctac
atttatggtgaaggcacatataccgggtctgacaacatcgtctacaagggaaggtggaaa
ttgaatcgtaagcatggacttggatgccagacgtaccctaatggagacatgtttgacggt
tcttggattcagggagaaatagaaggccatggcaagtatacgtgggcaaatggaaacact
tacgttggcaatatgaagaatggcaagatgtctgggaagggaactcttacttggaaaaat
ggggattcatatgaaggaaactggttagatggcatgatgcacgggtatggaatctataca
tggaatgagtgtgggtattatgttggtacttggaccaagggactgaaggatgggaaaggc
acattctatccaaaaggttgcagagttcctgttaatgatgagctctacatcaataatcta
agaaaccgaggtgtgctgcctgacattagaaggcagaatcacggctcacgcatccttcac
tcttcttcggttgacatggggaacatgaaggttggcttaactcgggaatcttcaggtcct
tcatctagaaggaactcaagtgagcaacctcattcgaaaaatgtatccttggaaagacgg
tggagccttgaggtggccattgaaaaattcattggccatgacgcaactggaagctctggc
ctagaaagatctgaaagcattaatgattctgatctgcctatgctggaacgggaatatatg
caaggtgttctaatcagcgaggtagtacttgacaggagtttttcggattcgtccaagaag
gcaaaacggcgccagaagaaaattgttagggagacaaaaaagccaggagagacaataatt
aagggtcacagaagctatgatcttatgctcagtctacagcttggaatcaggtacacggta
ggaaagattacgcccattcagaaacgtgaagtccgtgcttcagattttggtccacgagca
agtttctggatgaccttccccaaagaaggatcacgacttactccttcacatcctgcagaa
gacttcaaatggaaggactattgtcccatggttttcagaaatttgagggagatgttcaag
attgatgctgcagattatatgatctctatatgtggaaattctgcacttagggagttatct
tctccaggaaagagtggaagtgtctttttcctatcacaagatgatcgattcatgatcaag
actcttcggaaatctgaagtccaggttcttttacgaatgcttccaaaatattaccatcat
gtccgtacttatgagaacaccctcataactaagttttttggcctccacagggtgaagcct
tctagtggtcaaaagtttcgctttgttgtaatgggtaacatgttttgcacggaattgagg
attcatcggagatttgatttgaaaggttcatccttaggccgttctactgacaaaatcgaa
attgatgagaacacaactctgaaggatttggatcttaactattcattttatcttgaacct
tcctggcgtgaggctttacttaagcagattgaaactgacagtgaatttctaaggacccaa
cggataatggattacagcttattgcttggtgtgcactatagagctccccagcaccttcgg
acgcgtgcatcttatcatcgaagcatggcagcagatagattaactgttctttcagaagaa
gacgctcaggaggacgatgctttcaactacccggaaggtctagtgttggttcaaagaggt
ggtgatgaaaacagtgtggttgttggccctcacataagaggtagccgtttacgatcaaca
gccgctggatttgcggaagtagatctactacttcctggtacagccaggctgcagatccag
ctaggggttaacatgcctgcaagggcagagcagaaccctaaagaagaggaaagcaaatcg
tttcgggaggtgtacgacgtggtcctttacctgggtatcatagacatattgcaggagtac
aacatgtcaaagaagatagagcatgccgtcaagtccatgcagtacgactccatctccatc
tccgccgtggacccccagttctactcggagcgtttcctcaagttcatccagaccgtcttt
ccagaaaattcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332323
Entry
4332323           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4332323
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4332323
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4332323
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4332323
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     4332323
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4332323
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    4332323
 Endosome - Golgi transport
  Others
   Others
    4332323
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 4332323
NCBI-ProteinID: XP_015629198
LinkDB
Position
3:8558599..8563528
AA seq 520 aa
MPPQQGECCRHGWLGVGEAAVGGGGEEPFYVPLRKRLSVDGKASTAPRICIWECDGEAGD
ITCDIVAAPLRRSCSAKAMPPPAPLFRMMTPPPPRPQRGDGEEARRPGEAIRKGHRSYSL
MLNLQLGISYSVGKSSALPFQKLAASDFDPREKVWTRFPPEGSKFTPPHHSVDFRWKDYC
PAVFRHLRKLFGVDPAEYMLAICGNDTLRELASPGKSGSCFFITQDDRFMIKTVKKSEVK
VLIRMLRSYYEHVRQYKSTLLTRFYGTHCIKQAGCPKVRFIIMGNFCCSEYKIHRRFDLK
GSSHGRTIDKTERKIDETTTLKDLDLQYAFRLQRFWYEELMKQIQMDCTFLETQGIMDYS
LLLGVHFRNDYSVSKIGISQHIAFPKSTGKRKSFEGGSSFCELCFVESGCKDRDLIDSRK
PFIQLGINMPAQAERSSKKILDNFLLNERHLFITPPSGGSCDVYLFFGIIDILQDYDITK
KLEHAYKSFQVNPDYISAVDPKLYSRRFQDFIRRVFIKEQ
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgccgccgcagcagggggagtgctgccgccacggctggctcggcgtgggggaggccgcg
gtgggcggcggcggggaggagccgttctacgtgccgctgcgcaagcggctgtcggtggac
ggcaaggcatccacggcgccgcggatatgcatctgggagtgcgacggcgaggccggggac
atcacctgcgacatcgtcgccgcgccgctccgccgcagctgcagcgccaaggcaatgccg
ccgccggccccgctcttccggatgatgacgccgccgccgccgaggccgcagagaggggac
ggggaggaggccaggaggcccggggaggccatccgcaaggggcaccggagctacagcctc
atgctcaacctgcagcttggcataagctattcggtggggaagtcgtcggcgctgccgttc
cagaagctcgccgcgtcggacttcgacccgcgggagaaggtatggacacggttcccgccg
gaggggtccaagttcacgccgccgcatcactcggtggatttccggtggaaggactactgc
cctgccgtcttcaggcacctgaggaagctgttcggggtggaccctgcggagtacatgctc
gccatctgcggcaacgacacgctccgggagctggcgtccccgggcaagagcgggagctgc
ttcttcatcacgcaggacgatcggttcatgattaaaaccgtgaaaaagtccgaagtgaag
gttcttatccggatgttgcggagttactacgaacatgttcgtcagtataagtccacttta
ctaacaaggttttatggcacacattgcattaagcaagctggctgccccaaggtccggttc
attataatgggcaatttttgctgttcggaatataagatccataggcgttttgatctgaaa
ggttcctcacatggtcggactatcgacaaaacagagcgcaagattgatgaaaccactact
ctcaaggacctcgaccttcagtatgcatttcggttgcagagattttggtacgaggagctt
atgaagcaaattcagatggactgcacattcttggagacacagggcattatggactatagc
ctattgttaggagttcactttcgtaatgattactcagtgtctaaaataggcatatctcag
cacatagctttcccaaaatctactggcaaaagaaaatcatttgaaggtggaagcagtttt
tgtgagctctgctttgtggaatcaggttgcaaagacagagatttgatagactctcggaag
ccattcatccagttgggaattaacatgcctgcccaggcagagcgcagctcaaaaaaaata
ttagataattttctcctaaatgaaagacacttgttcataaccccaccaagtggaggatca
tgtgatgtctacctcttctttgggataatcgacattcttcaggactatgatataacgaag
aaattggaacatgcctacaagtccttccaggtcaaccctgactacatttctgctgtagac
ccaaagctatactcgagaaggtttcaggatttcatccgcagggtgttcataaaagagcag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333833
Entry
4333833           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4333833
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4333833
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4333833
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333833
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     4333833
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4333833
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    4333833
 Endosome - Golgi transport
  Others
   Others
    4333833
SSDB
Motif
Pfam: PIP5K MORN
Other DBs
NCBI-GeneID: 4333833
NCBI-ProteinID: XP_015631020
LinkDB
Position
3:28179878..28185949
AA seq 774 aa
MARAETSKGSIQRGNTLPNGDIYVGSFDGLVPHGPGKYMWTDGALYDGEWDKSKMTGRGL
IQWPSGASYEGDFRGGFIDGAGTFKGVDGSVYKGSWRMNKKHGMGTMVYSNSDTYEGFWN
EGLPDEFGKYTWADGNVYIGRWKSGKMNGSGVMQWINGDTLDCNWLNGLAHGKGYCKYAS
GACYIGTWDRGLKDGHGTFYQPGSKIPCNLEVSDCLTSHDGTSASSSSNEKITIGLLFLL
QKLCKNWRLRRFLHRPRRISNGTTPVFDDNSGSHLCQDVSSKSFSADDQCLQDSEVDKDS
VYEREYVQGVLIMEQPKNEDSRMSESGIAQENNWEKQAKGPMETIYKGHRSYYLMLNLQL
GIRYTVGKITPVPLREVRSNDFGPRARIKMYFPCEGSQYTPPHYSVDFFWKDYCPMVFRN
LREMFHIDAADYMMSICGGDSLKELSSPGKSGSIFYLSQDERFVIKTLRKTELKILLKML
PKYYNHVKAYDNTLITKFFGVHRITLKPGRKVRFVVMGNMFCTELRIHRKYDLKGSTQGR
STKKQNINENTTLKDLDLSYVFHVDKPWREALFRQIALDCMFLESQSIIDYSMLLGIHFR
APNHLKRITSCQNALESTGISAETECSVALHHEETISSKGFLLVAADEPGPAVRGSHIRG
SMVRAAEGGYEEVDLVLPGTGRFRVQLGVNMPARARKVQEDVNVEVENRDTIEEYDVVLY
LGIIDILQEYNVSKRVEHAVKSLKFDPLSISAVDPNLYSRRFISFLEKVFPEQD
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggcccgagcagagacaagcaaggggagcatccagaggggtaatacccttccaaatggg
gacatctacgtggggagcttcgatgggttagtccctcatggaccgggaaagtatatgtgg
acagatggagctctttatgatggtgagtgggacaagagtaaaatgaccgggagaggacta
attcagtggccttctggtgcatcctatgaaggtgacttccgtggaggtttcattgatgga
gcaggcactttcaagggagttgatggctcagtttacaaaggttcttggaggatgaacaag
aagcatggtatggggacaatggtttactctaactccgacacttatgaaggtttctggaat
gaaggtttacctgatgaatttggtaaatacacatgggctgatggcaacgtatacattgga
agatggaaatcaggcaaaatgaatggcagcggggtaatgcagtggataaatggtgatact
cttgactgtaattggctcaatggcctggctcatggcaaaggttactgcaaatatgcatct
ggggcttgctacattggtacatgggatagaggactaaaggatggccatggtacattttat
caacctggaagcaaaattccttgtaaccttgaagtttctgactgtctaacaagtcatgat
ggtacaagtgcttcaagttctagtaatgaaaagatcactattggactgttatttctattg
caaaaactgtgcaagaattggaggttgcgtaggtttcttcatcggcccagacgtatttca
aatggtaccacaccagttttcgatgataattctggaagccatctatgccaagatgtatca
agtaaatcattttcagctgatgatcagtgtctacaagacagtgaagttgataaagattcg
gtttatgaacgggaatacgtacaaggagtgcttatcatggaacaaccaaaaaacgaagat
tcaagaatgtcggagagcggtatagcacaagaaaataactgggagaaacaagctaaagga
ccaatggagactatttacaagggccataggagctattatctaatgcttaacttgcaactt
ggcatcaggtatactgtaggtaaaattacccctgtgcctttgcgtgaagttcgttcaaat
gattttggacctcgagcacgaataaaaatgtacttcccttgtgagggatcccagtatacc
cctccgcactactctgtcgatttcttttggaaagactattgtccgatggtcttccggaat
cttcgagaaatgtttcatatcgatgctgcagattacatgatgtctatatgtggtggtgat
agtctaaaggagctttcttcacctgggaaaagtggcagcattttctatctttctcaagat
gaacgttttgttataaaaacattgaggaaaactgagctgaagatactattgaagatgctt
ccaaagtattacaatcatgtcaaagcttatgataatacgctcattacaaaattctttggc
gtgcacaggattactctgaaacctggaagaaaggtccgttttgttgtcatgggaaatatg
ttttgtactgaactgcgaattcatcgtaagtatgacttaaagggctctacacaaggccga
tcaacaaagaagcaaaatataaatgagaacacaacactaaaggaccttgacctatcatat
gtttttcacgtggataaaccatggagggaggcacttttcaggcagatagctcttgattgt
atgttcctggaatcccaatctataattgactatagcatgctattgggaatccatttccga
gctcccaatcacctgaagcgtatcacatcatgtcagaacgctcttgaaagtactggaatt
tcagctgaaacggaatgtagtgttgcactgcatcatgaggagacaatttcttcaaaggga
tttctactagttgctgctgatgagccaggtccagcagtacgtggttcgcacataagagga
agcatggttagggcagcagaaggtggttatgaagaagttgatcttgttttgccaggcact
ggaaggttccgtgttcagctaggggtgaatatgccagctcgagctcggaaagtgcaagag
gacgtgaacgtagaagtagaaaacagggacaccattgaagagtatgatgttgtcctatac
cttggtatcatcgacatactacaagagtataatgtgtccaaaagagttgagcatgctgtc
aaatcactaaaattcgaccctctttcgatatcagctgttgatccaaatttgtattcgaga
cgatttataagtttcttggagaaggttttccccgagcaagattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333853
Entry
4333853           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 1
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4333853
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4333853
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4333853
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4333853
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     4333853
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4333853
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    4333853
 Endosome - Golgi transport
  Others
   Others
    4333853
SSDB
Motif
Pfam: PIP5K MORN
Other DBs
NCBI-GeneID: 4333853
NCBI-ProteinID: XP_015633005
UniProt: Q8LN60 B9FAT9
LinkDB
Position
3:complement(28358093..28362631)
AA seq 731 aa
MRRVAPAMIAAAAGGGGGYDGEEADAGAAVVEKALPNGDVYRGGFAGGAPHGKGKYVWAD
GCMYEGEWRRGKASGKGRFSWPSGATFEGEFRGGRIEGQGVFVGPDGATYRGAWAADRRH
GVGAKSYANGDYYEGQWRRNLQDGHGRYVWANGNQYVGEWRAGVISGRGVLIWANGSRYD
GVWENGVPRGTGVFTWPDGSRYVGSWPRSCVDMPAISGTFFPPVGAGGGGAVRKRSSVEG
VGDKASAVPRICIWESEGEAGDITCDIVDALEASMLYREATTVGGGVPYVRTQRSTRRVA
SGGTCWAPSAAATPEGKRPGQTISKGHKNYELMLQLQLGIRHSVGKSAAVPMRELSPADF
DPKEKFWTRFPPEGSKVTPPHSSSDFRWKDYCPMVFRHLRKLFSVDPADYMIAICGNDAL
RELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKLLIRMLPSYYQHVSQYRDSLITRFYGVH
CVKPLNGQKVRFIVMGNLFCSEYRIHRRFDLKGSSYGRTADKFDDEIDETTTLKDLDLNF
VFRLQRTWFRDLHEQLRRDCEFLESEGIMDYSFLVGVHFCDDLSASKTGLSTFTASPKFS
MKRESFQGGGGMPELCFSDSDFDRIPDCRKPLIRLGAHMPARAEQASRRSEFDPFLLNGG
GFLAPNQTGEVYDVILYFGIIDILQDYDITKRLEHAYKSLQTDPNSISAVDPKLYSKRFQ
DFIGRIFVEDG
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgaggcgggtcgcgccggcgatgatcgccgcagctgccggcggtggcggcgggtacgac
ggggaggaggcggatgcgggggcggcggtggtggagaaggcgctgccgaatggggatgtg
taccgcggcgggttcgccgggggcgcgccgcacgggaaggggaagtatgtgtgggcggat
gggtgcatgtacgagggggaatggcggcgggggaaggcgtccgggaaggggaggttctcg
tggccgtcgggggccacgttcgagggggagttccgcggcgggcggatcgaggggcagggc
gtgttcgtcggccccgacggcgccacgtaccggggcgcgtgggcggcggaccggcggcac
ggcgtgggcgccaagagctacgccaacggggactactacgaggggcagtggcgccgcaac
ctgcaggacggccacggccgctacgtgtgggccaacggcaaccagtacgtcggggagtgg
cgcgccggggtgatctccggccgtggcgtgctgatctgggccaacgggagccgctacgac
ggcgtgtgggagaacggcgtcccgaggggcaccggggtgttcacctggcccgacgggagc
cgctacgtgggttcctggccgaggagctgcgtcgacatgccggccattagcggcacgttc
ttcccgccggtcggcgccggtggcggaggcgcggtgaggaagaggtcctccgtcgaggga
gtaggtgacaaggcgtccgccgtccctcggatctgcatctgggagtccgagggcgaggcg
ggggacatcacctgcgacatcgtggacgcgctcgaggcgtccatgctctaccgggaggcc
acgacggttggaggtggtgtgccgtacgttcgcacacagcggagcacccggcgagtagcc
agcggaggcacgtgctgggcgccatcggcggctgctacaccggagggcaaaaggccaggg
cagacaatctccaaggggcataagaactacgagcttatgctgcagctgcaattggggata
aggcactcagtggggaagtctgcggcagtgccaatgcgggagctttcgcctgcagatttt
gatccaaaggagaagttctggacacgattcccacctgagggatcaaaggtcacaccacca
cattcctcttcagatttccggtggaaggactactgccctatggtgttcaggcacttgagg
aagttgttctcagttgatccagcagattacatgatcgcgatctgcgggaatgatgcattg
agagagctgtcttcacctggaaaaagtgggagcttcttttaccttacccaggatgatcgt
ttcatgattaagacagtgaagaaatcagaagtgaagttgctaattcggatgttacctagc
tattaccaacatgtaagtcaatatcgtgactctctaattacaaggttctacggtgtccac
tgtgtgaagcctcttaatggacagaaggtccgatttattgttatgggtaatttattctgc
tcagaatatcggattcatcgccgttttgatctaaaaggttcatcctatggacggacagca
gacaaatttgatgacgagattgatgagacaaccactctcaaggacttggatctcaacttt
gtttttcgattgcaacgaacttggtttagagatctccatgagcaactcaggcgggattgt
gaatttttggaatcagaagggatcatggactacagtttcttagtgggagttcacttttgt
gatgacctctctgcctcaaagacaggcttatctacttttacagcttctcctaagttttca
atgaagagggagtcgttccaaggtggtggtggcatgccagagctgtgcttctcagatagt
gattttgataggatacctgattgccggaaaccattgattagactgggggcacacatgcca
gcacgggcagagcaagcatccagaaggagtgagtttgacccatttctccttaatggtggg
ggattcttggccccgaatcagactggtgaagtgtatgatgtgattctatattttgggata
atagacattctccaggattatgacatcacgaaaaggctagagcatgcatacaagtcatta
cagaccgaccccaattcgatttctgctgtggatccaaagctctattcgaaaagatttcaa
gatttcattggcagaatttttgtggaagatggctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344166
Entry
4344166           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 6
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4344166
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4344166
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4344166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4344166
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     4344166
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4344166
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    4344166
 Endosome - Golgi transport
  Others
   Others
    4344166
SSDB
Motif
Pfam: PIP5K MORN
Other DBs
NCBI-GeneID: 4344166
NCBI-ProteinID: XP_015645333
UniProt: Q0D3Y7 Q7XAM7
LinkDB
Position
7:complement(27752688..27757299)
AA seq 791 aa
MHEHIRARAWEATVRKVVQQQQPQPQPGGSRRRVSPMLAADDPETASSSSASTAGGGDDG
GYVERGLPNGDFYTGQWRGGAPHGAGKYLWTDGCMYEGEWRHGKATGRGRFSWPSGATYE
GEFRDGFMDGAGTYTGAAGDTYRGSWSMNLKHGHGKKSYANGDHYDGEWRSGLQDGAGRY
IWRNGTEYTGQWRGGLIHGRGALVWSNGNRYDGGWEDGCPRGQGTFRWADGSVYVGYWTR
DAATGIVQQKGVYYPSPAASSPTARDPRDVFARDLPGFMGGAAEPAASLPHRSLNHSGNR
GGAAAAAGNARSSSASGLSNSSGGDRKYDKICIWESDGDITCDIVDGAALADEAVGPRRS
IKAAAAGDGLVLAPPSPAPRIAKWVPPREAKRQGETIAKGHKNYELMLNLQLGIRHAVGK
QGPVTLDLKSSAFDPKEKVWTKFPPEGSKYTPPHNSCDFKWKDYCPQVFRTLRKLFKVDA
ADYMLSLCGSEALRELSSPGKSGSFFYLTNDDRYMIKTMKKSEVKMLLKMLPAYYNHVRS
FENTLVTKFFGLHCVKLAGANQKKVRFVIMGNLFCSDHSIHRRFDLKGSSLGRTTDKPQT
EIDQYTTLKDLDLNFIFRLKKQWFHEFQRQVDRDCDFLEQEKIMDYSLLVGVHFRGNREK
LLSEGSTDYDINKISTPRLSRGNVDQCLTDPNRWPKIKLGANMPARAELTARKNDLEPQL
IGEPTGEYYDAILYFGIIDILQDYDISKKLEHAYKSFQYDPTSISAVDPRQYSRRFKDFI
YKAFQEDRLDS
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgcacgagcacatccgcgccagggcgtgggaggcgacggtgcgcaaggtggtgcagcag
cagcagccgcagccgcagcctgggggcagcaggcgccgcgtgtccccgatgctggccgcc
gacgaccccgagacggcgtcctcgtcgtcggcgtccacggccggcggcggcgacgacggc
gggtacgtcgagcgcggcctccccaacggtgacttctacacgggccagtggcgcggcggc
gcgccgcacggcgccgggaagtatctgtggacggacgggtgcatgtacgagggcgagtgg
cggcacgggaaggcgacggggaggggcaggttctcgtggccgtcgggcgccacgtacgag
ggggagttcagggacgggttcatggacggcgccgggacgtacaccggcgccgccggggac
acgtaccggggctcgtggtccatgaacctcaagcacggccacggcaagaagagctacgcc
aacggcgaccactacgacggcgagtggcgctccgggctccaggacggcgccggccgctac
atctggcgcaatggcaccgagtacacggggcagtggcgcggcggcctcatccatggccgc
ggcgcgctcgtctggtcgaacggcaaccgctacgatggcgggtgggaggacgggtgcccc
cgcgggcagggcaccttccgatgggccgacggcagcgtctacgtcggctactggacgcgc
gacgccgccaccggcattgtccagcagaagggcgtctactacccgtccccggcggcgtcc
tccccgacggcgcgcgacccccgcgacgtgttcgcgagggacctcccgggcttcatgggc
ggagccgccgagccggccgcgtctctgccgcacaggtcgctgaatcactccggcaacaga
ggcggcgccgcggcggcggcgggcaatgcgcggtcgagctccgcgtcggggctgagcaac
agctccggcggcgacaggaagtacgacaagatttgcatttgggagtccgacggggacatc
acctgcgacattgtcgacggcgccgcgttggccgacgaggcggtgggccccaggaggagc
atcaaggcggccgccgccggtgatgggctggtcctcgcgccgccgtcgccggcgccgcgc
atcgccaagtgggtgccaccgcgggaggcgaagcggcagggcgagaccatcgccaagggt
cacaagaattacgagctcatgctcaacttgcagctcgggatcaggcatgcagtcgggaag
caaggtccagttacgcttgatctgaaatcctcggcttttgacccaaaggaaaaagtatgg
acaaagttccctccagaaggctcaaaatacacccctccgcacaattcttgtgatttcaaa
tggaaggattactgccctcaggtgttccggacgctgcgcaagttgttcaaggtggatgct
gctgattatatgttatccctttgtggaagtgaggctctgcgtgagctctcttctcctggt
aaaagtggaagcttcttttaccttacaaatgatgatcgatacatgataaagacaatgaag
aaatcggaagtaaagatgctgcttaagatgcttcctgcttactataatcatgtccgttca
ttcgagaacactctagttaccaaattttttggtctacattgtgttaaattagctggggca
aaccagaaaaaggttcgctttgtcatcatgggaaatctgttctgctctgatcattccatc
cataggcgttttgatctaaaaggctcgtctcttggccgaacaactgacaagccacaaact
gagattgatcagtatacaactctgaaggatcttgatctgaatttcatatttagactgaag
aagcaatggttccatgagttccaaaggcaagtggacagggattgcgatttccttgagcag
gagaagatcatggattacagtcttctggtgggtgtacattttagaggcaatagagagaag
cttctgagcgaaggttccaccgattacgatatcaacaaaatatctactcctcgtctttca
agaggaaatgtggatcagtgtctcactgatccaaacaggtggcctaaaatcaagctcgga
gcaaacatgcctgcaagagctgaactgactgctcggaagaatgatttggaaccacagctt
attggagagccaactggggagtattatgatgctatattatattttgggataatagacata
cttcaagattatgatatcagcaaaaagctcgagcatgcatacaaatctttccagtatgac
ccaacctcaatatcagcggtggacccaaggcagtactctagacgttttaaagattttata
tacaaagcatttcaagaagacaggctagatagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349758
Entry
4349758           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 6
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4349758
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4349758
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4349758
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4349758
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     4349758
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4349758
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    4349758
 Endosome - Golgi transport
  Others
   Others
    4349758
SSDB
Motif
Pfam: MORN
Other DBs
NCBI-GeneID: 4349758
NCBI-ProteinID: XP_015616799
LinkDB
Position
11:complement(2087698..2089563)
AA seq 495 aa
MNPLPALASRLWEASIRKLKYSTILRGSVVPSGGTFDGPAAATGNAAGGDPITLTPSLSV
SSSTSNTIYQYDDGDEDIDSVLDDVDTDDDDVDEASLGEPSHSDQLLPSGDFYQGDLRCD
LPHGAGKYLWTDGSMYEGSWRGGRAAGRGKFSWSSGAIYEGDLAGGYMHGQGTYIGELGD
TFAGLWANNLRHGRGTQAYVNGDVYDGHWRDGLQDGHGQYIWRGGHEYIGTWKAGEMHGR
GTVIWADGDRYDGAWEDAKPKGQGTFRWSDGGMYIGLWCQESGETQGKGVYYPPSGGPAV
PLPREPKGVITKLLEELEMSEGKTVSLLPSQKVLTWPGVEPVTKKPVWLPPEVAADQGMW
RPPEVGADQGRRSSRRNNMSSDIDSLVEGEDGGEESRNDRSWVRTPSCMRAPTMPKPGKK
QGETISKGHKNYELMLNLQLGIIWIKLDVPIIYLYLVFTVHYQRVFFFQITLKFLAFDRH
KDSCNIIGPAVLLSG
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgaacccgctccctgctctggccagccggctgtgggaggcgagcatccgcaagctcaag
tactccaccatccttcgcggctccgtcgtcccctccggcggcaccttcgacggaccggcg
gccgccaccggcaatgccgctggaggtgaccccatcacgctcaccccaagcctctccgtc
agctcctccacctccaacaccatctaccagtacgacgacggcgacgaagacatcgactcc
gtcctcgacgacgttgacaccgacgacgacgacgtcgacgaggcgtcgctcggcgagccc
agccactccgaccagctgctgcccagcggagacttctaccagggcgacctacgctgtgac
ctcccccacggcgccggcaagtatctctggacggacggcagcatgtacgaggggtcgtgg
cgcggcggccgcgcggccggccgcggcaagttctcgtggtcgtcgggcgccatctacgag
ggcgacctcgccggcgggtacatgcacggacaggggacgtacatcggcgagctcggggac
acgttcgccgggctgtgggcgaacaacctccggcacggccgcggcacgcaggcgtacgtc
aacggcgacgtgtacgacggccactggcgcgacgggctgcaggacgggcacggccagtac
atctggcgcggcggccacgagtacatcgggacgtggaaggccggcgagatgcacggccgc
gggacggtgatatgggcggacggcgaccggtacgacggcgcgtgggaggacgccaagccc
aaggggcagggcacgttccggtggtccgacggcgggatgtacattggcctgtggtgccag
gagtccggcgagacgcagggcaagggcgtgtactacccgccgtccggtggcccggcggtg
ccgttgccccgggaacccaagggggtgatcacgaagctgctcgaggagctggagatgtcc
gaggggaagacggtgtcgctgctgccgtcacagaaggtgctgacatggcctggggtggag
cccgtgacgaagaagccggtgtggctgccgccggaggtcgccgctgaccaagggatgtgg
cggccgccggaggttggagctgaccaagggaggaggtcgagcaggaggaacaacatgtcg
tccgacattgacagcctggttgagggggaggacggcggcgaggagagtcgcaacgacagg
tcatgggtgcggacaccgtcgtgtatgcgcgcgccgacgatgccgaagccggggaagaag
cagggggagaccatctccaaggggcacaagaactacgaactgatgctcaacttgcagctg
ggaataatatggataaaattagatgtacctatcatttatttgtatttggtttttactgta
cattaccagcgtgttttttttttccaaatcacactcaaattcctagcctttgatagacat
aaagattcgtgcaacattatcgggcccgcagtccttttatcgggttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351470
Entry
4351470           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 6
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    4351470
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    4351470
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4351470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4351470
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     4351470
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4351470
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    4351470
 Endosome - Golgi transport
  Others
   Others
    4351470
SSDB
Motif
Pfam: PIP5K MORN
Other DBs
NCBI-GeneID: 4351470
NCBI-ProteinID: XP_015618754
LinkDB
Position
12:complement(1989614..1994264)
AA seq 801 aa
MNPLPPPASRLWEASIRKLKYSTILRGSVVPSGAAFDGAAAAATGGDPVTLTPSLSVSSS
TSNTIYQYEDGDDDIDSVLDDVDTDDDDVDEASLGEPSHSDQLLPSGDFYQGDLRGDLPH
GAGKYLWTDGSMYEGSWRGGRAAGRGKFSWSSGAIYEGDLAGGYMHGQGTYIGELGDTFA
GLWANNLRHGRGTQAYVNGDVYDGHWRDGLQDGHGRYIWRGGHEYIGTWKAGEMHGRGTV
IWADGDRYDGAWEDAKPKGQGTFRWSDGGMYIGLWCQESGETQGKGVYYPPSGGPAVPLP
REPKEVITKLLEELEMSEGKTVSLLPSQKVLTWPGVEPVTKKPVWRPPEVAADQGMWRPP
EVGADQGRRSSRRNSMSSDIDSLVEGEDGGEETRNDRSWVRTPSCMRAPTLPKPGKKQGE
TISKGHKNYELMLNLQLGIRHAVGRQSAPASLDLKSSAFDPKEKVWTRFPPEGSKHTPPH
QSCDFRWKDYCPLVFRTLRKLFDVDPGDYMLSICGDDALLELSSPGKSGSFFYFTNDDKY
MIKTMKKAEVKVLLRMLPAYYKHVRSFDNTLVTKFFGLHCVKITGAIQKKVRFVIMGNLF
CSNYSIHRRFDLKGSSHGRTTDKPLDQIDETTTLKDLDLNFIFRLEGSWYEDFCRQVDKD
CEFLEQERIMDYSLLVGVHFKDRCKDSSSPDNETTQTALEDEEKRKAPVKLGIGMPSRVE
NVVKNPESESQLIGEPTGEFQDVILFFGIIDILQDYDISKKLEHAYKSMQYDPNSISAVD
PKQYCKRFRDFIYRAFSEDVQ
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgaacccgctccctcccccggccagccggctgtgggaggcgagcatccgcaagctcaag
tactccaccatcctccgcggctccgtcgtcccctccggcgccgccttcgatggtgcggcg
gcggcggccaccggaggtgaccccgtcacgctcaccccaagcctctccgtcagctcctcc
acctccaacaccatctaccagtacgaagacggcgacgacgacatcgactccgtcctcgac
gacgtcgacaccgacgacgacgacgtcgacgaggcgtccctcggcgagcccagccactcc
gaccagctgctgcccagcggagacttctaccagggcgacctgcgcggcgacctcccccac
ggcgccggcaagtatctctggacggacggcagcatgtacgaggggtcgtggcgcggcggc
cgcgcggccgggcgcggcaagttctcgtggtcgtcgggcgccatctacgagggcgacctc
gccggcgggtacatgcacggccaaggaacctacatcggcgagctcggggacacgttcgcc
gggctgtgggcgaacaacctccggcacggccgcggcacgcaggcgtacgtcaacggcgac
gtgtacgacggccactggcgcgacgggctgcaggatgggcacggccggtacatctggcgc
ggcggccacgagtacatcgggacgtggaaggccggcgagatgcacggccgcgggacggtg
atatgggcggacggcgaccggtacgacggcgcgtgggaggacgccaagcccaaggggcag
ggcacgttccggtggtccgacggcgggatgtacatcggcctgtggtgccaggagtccggc
gagacgcagggcaagggcgtgtactacccgccgtccggtggcccggcggtgccgttgccc
cgggaacccaaggaggtgatcacgaagctgctcgaggagctggagatgtccgaggggaag
acggtgtcgctgctgccgtcgcagaaggtgctgacatggcccggggtggagcccgtgacg
aagaagccggtgtggcggccgccggaggtcgccgctgaccaagggatgtggcggccgccg
gaggtcggagctgaccaagggaggaggtcgagcaggaggaacagcatgtcgtccgacatt
gacagcctggttgagggggaggacggcggcgaggagactcgcaacgacaggtcatgggtg
cggacaccgtcgtgtatgcgcgcgcccacgctgccgaagccggggaagaagcagggggag
accatctccaagggccacaagaactacgaactgatgctcaacttgcagctgggtatcaga
catgctgtaggaaggcagtcagctcctgcttcattggatcttaaatcatcagcatttgat
ccgaaagagaaggtgtggacaagatttcctcctgaaggatcaaagcatactcctcctcac
cagtcatgtgatttccggtggaaggactactgtccattggttttcaggactttgcgcaag
ctctttgatgttgacccaggagactacatgctctccatttgcggggatgatgcactgctg
gagctttcatctcccggtaaaagtggaagtttcttttatttcaccaatgatgacaagtac
atgatcaaaacaatgaagaaagcagaagttaaagtacttctgaggatgcttccagcctat
tataaacatgttcgatcttttgataatactctagtaacaaaattttttggcctgcattgt
gttaaaattacaggagctattcagaaaaaggttcggtttgttataatggggaatcttttc
tgctccaactattcaatccacagacgctttgatttgaaaggatcatcacatggtcgcaca
acggacaaacccctcgatcaaattgatgagactaccactttgaaggaccttgatctaaat
ttcattttccggttagagggatcatggtatgaagatttctgcaggcaagtggacaaagat
tgtgagtttctggagcaagagagaattatggattacagtcttctggttggcgttcacttc
aaagaccgatgcaaagacagcagcagtcctgacaacgagacaactcaaactgctcttgaa
gatgaggaaaaaagaaaagcaccagtcaagctagggattggcatgccctcaagggtggag
aatgttgtgaagaatcctgaaagcgaatcccagctcattggcgaaccaacaggggaattc
caggacgttatcctgttctttggaatcattgatatcctacaagactatgatatcagcaag
aagcttgagcatgcctacaaatccatgcaatatgatcccaactccatatcggctgttgat
ccaaagcaatactgcaaaaggttcagggacttcatttacagggcttttagtgaagacgta
cagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267438
Entry
9267438           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 6
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9267438
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9267438
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9267438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9267438
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     9267438
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    9267438
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    9267438
 Endosome - Golgi transport
  Others
   Others
    9267438
SSDB
Motif
Pfam: PIP5K MORN
Other DBs
NCBI-GeneID: 9267438
NCBI-ProteinID: XP_015628903
LinkDB
Position
3:13712222..13716749
AA seq 754 aa
MREHERRGRGRGGGGGGRVSPMPPGEDADTASSCSGADEGEAQAQAQGNEQQRAERVLPN
GDLYTGQWRGGSPHGAGKYLWADGCMYEGEWRRGKATGRGRFSWPSGATYEGEFLDGFMH
GAGAYVGAAGDTYRGAWAKNLEHGAGEKRYANGDCYDGEWRAGLPEGCGRYAWRDGTEYA
GGWRAGLIHGRGALVWANGNRYDGGWEGGRPRGQGTFRWSDGSLYVGFWGREAPGGAVHQ
KGVYYPSPAAAGESRDPREVFARELPECVRSSTEGQSALPSLRSLRWLARSISGRGSSSS
GRSIGSVVGVPHLWGSDGEVKPDIADDWRRRSSVREGRGPPPPSLAAPPPPPHVDKGAAP
PRVMKRQGVTIAKGHKNYELMLNLQLGIRHAVGRQGQVILDLKSSAFDAKEKVWTKFPPE
GSKYTPPHNSSDFRWKDYCPKVFRTLRKLFKVDPADYMLSLCGDDALRELSSPGKSGSFF
YLTNDDRYMIKTMKKSEVKMLLKMLPAYYNHVRAFEDTLVTKFFGLHCVKLAGANQKKVR
FVIMGNLFCSDHTIHRRFDLKGSSLGRTTNKPLAEIDEYTTLKDLDLNFIFRLQKQWFQE
FQRQVDKDCEFLEHEKIMDYSLLVGVHFRGAVDIDGDIPASPRLSRWDRDHFLSDPNRWS
KIKLGANMLSRAELTIRKNDTDVVGQPTGQYCDVILYFGIIDILQDYDIGKKIEHAYKSF
QYDSTSISAVDPRQYSRRFRDFIYNAFQEDRAES
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgcgcgagcacgaacggcgtgggcgagggagaggaggaggaggaggaggacgcgtgtca
ccgatgccccccggcgaggacgccgacacggcgtcgtcctgcagcggtgccgacgaaggc
gaggcgcaggcgcaggcgcaggggaatgagcagcagcgcgcggagcgggtgctccccaat
ggggacctgtacacggggcagtggcgcggcggctcgccgcacggcgccgggaagtacctg
tgggcggacgggtgcatgtacgagggggagtggcggcgggggaaggcgaccgggcggggg
aggttctcgtggccgtcgggcgccacctacgagggggagttcctcgacggcttcatgcac
ggcgccggcgcctacgtgggcgccgcgggggacacctaccgcggcgcctgggccaagaac
ctcgagcacggcgccggcgagaagcgctacgccaacggcgactgctacgacggcgagtgg
cgcgcgggcctcccggagggctgcggccgctacgcgtggcgcgacggcaccgagtacgcc
ggcggctggcgcgcgggcctcatccacggccgcggcgccctcgtctgggccaacggcaac
cgctacgacggcgggtgggagggcggccgcccccgcggccagggcaccttccgctggtcc
gacggcagcctctacgtcggcttctggggccgcgaggcccccggcggcgccgtccaccag
aagggcgtctactacccgtccccggcggcggcgggcgagtcccgcgaccccagggaggtg
ttcgcgcgggagctccccgagtgcgtccgctccagcacggaagggcagtcggcgctgccg
tcgctgcgttcgctgaggtggctggcgcggtcgatcagcggccgcgggagctcgtcgtcg
ggccggagcatcggctccgtggtgggcgtgccgcacctctggggctccgacggcgaggtc
aagcccgacattgccgacgactggaggcgccggagcagcgtcagggaggggaggggaccg
ccgccgccttcgctggcggcgccgccgccgccgccgcacgtcgacaagggggcggcgccg
ccgcgggtgatgaagcggcagggggtgaccatcgccaagggccacaagaactacgagctc
atgctcaacctgcagctcgggatcaggcatgcagtaggaaggcaaggccaggttatatta
gacctgaagtcatcagcatttgacgcaaaagaaaaagtatggactaaattccctccagaa
ggctcaaaatacacccctccacacaattcttctgatttcagatggaaggattactgccca
aaggtgttccggacattgcgcaagctgtttaaggttgatccagctgactatatgctatcc
ctttgtggagatgatgctctccgtgaactctcgtcccctggtaaaagtggaagcttcttt
tacttgacaaatgacgaccgctacatgataaagacaatgaagaaatctgaagtaaagatg
cttctgaagatgcttccagcttactacaatcatgttcgggcattcgaggataccctggtg
acaaagttttttggcctacattgtgtaaagttggctggagcaaatcagaagaaggttcgt
ttcgtcataatgggaaatcttttctgctctgatcacactattcataggcgatttgatctg
aaaggatcatctcttggccgtacaactaacaagccactggcagaaattgatgagtataca
actctgaaagatcttgatcttaatttcatctttcggttgcaaaaacaatggttccaagag
ttccaaaggcaagtagacaaggactgtgaatttcttgagcatgagaagatcatggattac
agtcttttagtgggtgtacattttagaggtgccgttgatattgatggtgacatacctgca
tcaccacgcctttcaagatgggacagggatcactttctttctgacccaaacaggtggtcg
aagattaaacttggggcaaacatgctgtcaagggctgaactgacaatcagaaagaatgac
actgatgtcgttggacagccaaccgggcagtactgcgacgtgatattatattttgggata
atagacatacttcaagactatgatatcggcaaaaagatcgagcatgcttacaagtctttt
caatacgactcgacatccatctcagcagtagacccaagacagtattccaggcgcttcaga
gatttcatatacaacgcgttccaagaagatcgagcagagagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269628
Entry
9269628           CDS       T01015                                 
Name
(RefSeq) phosphatidylinositol 4-phosphate 5-kinase 6
  KO
K00889  1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00562  Inositol phosphate metabolism
osa01100  Metabolic pathways
osa04070  Phosphatidylinositol signaling system
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    9269628
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9269628
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9269628
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9269628
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     9269628
Membrane trafficking [BR:osa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    9269628
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    9269628
 Endosome - Golgi transport
  Others
   Others
    9269628
SSDB
Motif
Pfam: PIP5K MORN Peptidase_C53
Other DBs
NCBI-GeneID: 9269628
NCBI-ProteinID: XP_015616798
LinkDB
Position
11:complement(2059406..2065695)
AA seq 797 aa
MNPLPPPASRLWEASIRKLKYSTILRGSVVPSGGTFDGAAAAAATGGDPVTLTPSLSVIS
STSNTIYQYEDGDDDIDSVLDDVDTDDDDVDEASLGEPSHSDQLLPSGDFYQGDLRGDLP
HGAGKYLWTDGSMYEGSWRGGRAAGRGKFSWSSGAIYEGDLAGGYMHGQGTYIGELGDTF
AGLWANNLRHGRGTQAYVNGDVYDGHWRDGLQDGHGRYIWRGGHEYIGTWKAGEMHGRGT
VIWADGDRYDGAWEDAKPKGQGTFRWSDGGMYIGLWCQESGETQGKGVYYPPSGGPAVPL
PREPKEVITKLLEELEMSEGKTVSLLPSQKVLTWPGVEPVTKKPVWRPPEVAADQGMWRP
PEVGADQGRNSMSSDIDSLVEGEDGGEESRNDRSWVRTPSCMRAPTLPKPGKKQGETISK
GHKNYELMLNLQLGIRHAVGRQSAPASLDLKSSAFDPKEKVWTRFPPEGSKHTPPHQSCD
FRWKDYCPLVFRTLRKLFDVDPGDYMLSICGDDALLELSSPGKSGSFFYFTNDDKYMIKT
MKKAEVKVLLRMLPAYYKHVRSFDNTLVTKFFGLHCVKITGAIQKKVRFVIMGNLFCSNY
SIHRRFDLKGSSHGRTTDKPIDQIDETTTLKDLDLNFIFRLEGSWYEDFCRQLDKDCEFL
EQERIMDYSLLVGVHFKDRCKDSSSPDNETTQTALEDEERRKAPVKLGISMPSRVENVVK
NPESESQLIGEPTGEFQDVILFFGIIDILQDYDISKKLEHAYKSMQYDPNSISAVDPKQY
CKRFRDFIYRAFSEDLQ
NT seq 2394 nt   +upstreamnt  +downstreamnt
atgaacccgctccctcccccggccagccggctgtgggaggcgagcatccgcaagctcaag
tactccaccatcctccgcggctccgtcgtcccctccggcggcaccttcgatggtgcggcg
gcggcggcggccaccggaggtgaccccgtcacgctcacgccaagcctctccgtcatctcc
tccacctccaacaccatctaccagtacgaagacggcgacgacgacatcgactccgtcctc
gacgacgttgacaccgacgacgacgacgtcgacgaggcgtcgctcggcgagcccagccac
tccgaccagctgctgcccagcggagacttctaccagggcgacctgcgcggcgacctcccc
catggcgccggcaagtatctctggacggacggcagcatgtacgaggggtcgtggcgcggc
ggccgcgcggctggccgcggcaagttctcgtggtcgtccggcgccatctacgagggcgac
ctcgccggcgggtacatgcacggccaggggacctacatcggcgagctcggggacacgttc
gccgggctgtgggcgaacaacctccggcacggccgcggcacgcaggcgtacgtcaacggc
gacgtgtacgacggccactggcgcgacgggctgcaggacgggcacggccggtacatctgg
cgcggcggccacgagtacatcgggacgtggaaggccggcgagatgcacggccgcgggacg
gtgatatgggcggacggcgaccggtacgacggcgcgtgggaggacgccaagcccaagggg
cagggcacgttccggtggtccgacggcgggatgtacatcggcctgtggtgccaggagtcc
ggcgagacgcagggcaagggcgtgtactacccgccgtccggtggcccggcggtgccgttg
ccccgggaacccaaggaggtgatcacgaagctgctcgaggagctggagatgtccgagggg
aagacggtgtcgctgctgccgtcgcagaaggtgctgacatggccaggggtggagcccgtg
acgaagaagccggtgtggcggccgccggaggtcgccgccgaccaagggatgtggcggccg
ccggaggtcggagctgaccaagggaggaacagcatgtcgtccgatattgacagcctggtt
gagggggaggacggcggcgaggagagtcgcaacgacaggtcatgggtgcggacaccctcg
tgtatgcgcgcgccgacgctgccgaagccggggaagaagcagggggagaccatctccaag
gggcacaagaactacgaactgatgctcaacttgcagctgggtatcagacatgctgtagga
aggcagtcagctcctgcttcattggatcttaaatcatcagcatttgatccgaaagagaag
gtgtggacaagatttcctcctgaaggatcaaagcatactcctcctcaccagtcatgtgat
ttccggtggaaggactactgtccattggttttcaggactttgcgcaagctctttgatgtt
gacccaggagactacatgctctccatttgcggggatgatgcactgctggagctttcatct
cccggtaaaagtggaagtttcttttatttcaccaatgatgacaagtacatgatcaaaaca
atgaagaaagcagaagttaaagtacttctgaggatgcttccagcctattataaacacgtt
cgttcttttgataatactctagtaacaaaatttttcggcctgcattgtgttaaaattaca
ggagctattcagaaaaaggttcggtttgttataatggggaatcttttctgctccaactat
tcaatccacagacgctttgatttgaaaggatcatcacatggtcgcacaacggacaaaccc
attgatcaaatcgatgagactaccactttgaaggaccttgatctcaatttcattttccgg
ttagagggatcatggtatgaagatttctgcaggcaattggacaaggattgtgagtttctg
gagcaagagagaattatggattacagtcttctggttggcgttcacttcaaagaccgatgc
aaagacagcagcagtcctgacaacgagacaactcaaactgctcttgaagatgaggaaaga
agaaaagcaccagtcaagctagggatcagcatgccctcaagggtggagaatgttgtgaag
aatcctgaaagtgaatcccagctcattggcgaacctacaggggaattccaggacgttatc
ctgttctttggaatcattgacatcctacaagactatgatatcagcaagaagcttgagcat
gcctacaaatccatgcaatatgatcccaactccatatcggctgttgatccaaagcaatac
tgcaaaaggttcagggatttcatttacagggcttttagtgaagacctacagtaa

DBGET integrated database retrieval system