KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331189
Entry
4331189           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L9, chloroplastic
  KO
K02939  large subunit ribosomal protein L9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331189
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331189
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4331189
  Bacteria
    4331189
SSDB
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N NTP_transf_5
Other DBs
NCBI-GeneID: 4331189
NCBI-ProteinID: XP_015624692
UniProt: A0A5S6R9G6 Q6KA00
LinkDB
Position
2:complement(35320468..35322981)
AA seq 187 aa
MASTLAWSSAASSSAPSSRLPPRRSPSLVVVAQGKVKKYRQVILTDDIAEVGKKGDTLKV
RAGFYRNFLLPKGKATLLTPEVLKEMQVEQERIDAEKKRVKEEAQQLARVFETIGAFKVP
RKGGKGKQIFGSVTAQDLVDIIKSQLNRDVDKRLVTVPEIREIGEYIAEIKLHPEVTAQV
RLTVYAK
NT seq 564 nt   +upstreamnt  +downstreamnt
atggcctccacgctcgcctggagctccgccgcctcctcctccgccccctcctcccgcctc
ccgccgcgccgctccccgtcgctggtcgtcgtcgcccagggcaaggtcaagaagtatcgc
caggtcatactgacagatgacatagcagaggtggggaagaaaggggacacgcttaaagtg
agggccgggttctaccgcaacttccttctgccaaagggcaaggcaacgctgctcacccca
gaagtactcaaggaaatgcaagtagaacaggagaggatagatgctgaaaagaagcgggta
aaagaagaggcacagcaacttgcccgtgtttttgaaactattggggcattcaaagtgcca
cgtaaaggtgggaaaggaaaacagatatttgggagcgtcacagcacaagatcttgttgac
atcataaagtcacaacttaatagggatgtcgacaagcgtctcgtgacagtgccagaaatt
cgtgaaattggggaatacattgcagagattaagcttcaccctgaagtcacagctcaagta
aggctgaccgtatatgcgaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339400
Entry
4339400           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339400
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4339400
  Bacteria
    4339400
SSDB
Motif
Pfam: Ribosomal_L9_N Ribosomal_L9_C Neurobeachin DUF3349 DUF4777
Other DBs
NCBI-GeneID: 4339400
NCBI-ProteinID: XP_015639505
UniProt: Q65XC5 B9FL94
LinkDB
Position
5:26276577..26279409
AA seq 206 aa
MASARAALLRRHCLAAAGGANPVLFSGHGLRYRKLEVILTTTIDKLGKAGEVVKVAPGHF
RNHLMPKMLAVPNIDKFALLIHEQRKLYQRQEEEVVKEVRQEDDDAKQQEEKLKEYQTAA
KCLDNALLVLRRFISVGNELRSPVTKDEIVSEVARQLNINIHPDNLHLPSPLASLGEFEL
PLRLPRDIPRPEGKLQWTLTVKIRRK
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcgtccgcccgcgccgcgctcctccgccgccactgcctcgccgcagccggcggcgcc
aaccccgtgctcttctccggccatggcctccgctaccgcaagctggaggtcatcctcacc
acgacgattgataagctggggaaagcgggggaggtagtgaaggtggccccaggacacttc
cgcaaccaccttatgcccaagatgctcgctgtcccaaacattgacaaattcgctctactc
atccatgagcagcgcaagctttaccaacgtcaagaggaggaggtggtgaaagaagtccga
caagaagatgatgatgctaagcaacaggaagagaaactgaaggagtatcaaacggcagca
aagtgtcttgataatgctctcttggtgttgaggagattcatctcagttgggaatgaactg
cggtctcctgtgacaaaggacgaaattgtttccgaggttgcaaggcaactcaatatcaat
atccacccagacaatcttcacctgccgtcaccattggcatcccttggggagtttgagctg
cccctccgtttgccaagggatataccacgcccagaaggcaagctacaatggactctaacg
gttaagatcagaagaaaataa

DBGET integrated database retrieval system