KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331250
Entry
4331250           CDS       T01015                                 
Name
(RefSeq) beta-catenin-like protein 1
  KO
K12864  beta-catenin-like protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4331250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4331250
Spliceosome [BR:osa03041]
 Complex B
  Other components
   Prp19 complex
    4331250
 Complex C
   Prp19-CDC5 complex
    4331250
SSDB
Motif
Pfam: CTNNBL Cas_Cmr5 DUF6042 DUF936 Ost5
Other DBs
NCBI-GeneID: 4331250
NCBI-ProteinID: XP_015622617
UniProt: A0A0P0VRL8
LinkDB
Position
2:complement(35747187..35751292)
AA seq 516 aa
MDAAHKRKRPDADDDGAAGAVDLSSLEGADDVEVLDLRAAKRLLLAFERRLRDNLEARMK
HPDDPARFADSEIALHAETDRLRLLAGAPDLFPDLVPLGLASSLSSLLTHDNADLAAAAA
SLLADLTDSDDPDDLAGLHSLADALVEANALDLLVHNLSRFSEADPDEAEAVHHTLSVVE
NLLELRPQLADIVCDRTKLLRWLLARLKAREFDANKQYASEILAILLQDSPANQKRLGNI
NGVDGLLQAVAMYKSRDPKTSDEEEMLENLFDCLCCVLMPMENKERFVKAEGVELMIIIM
KQKKLAYSSAIRTLDFAMTRFPPACERFVDVLGLKTAFAAFMGKIPVNKKNKKESYQEAL
EERVISLIASLFGGITKGSRRIRLLGKFVENECEKIDRLMEFYTRYSERVKAETERLDSL
DLDDLEMDEDERYNRKLEAGLYTLQLIALILGHIWHSGNSQMRTRIELLLRQNKLTKDDV
KDILEEYHDNIGDLDGPEEKERAQGRTKEIIASLSL
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggatgcggcgcacaagcgcaagcggccggacgccgacgacgacggcgctgcgggggcg
gtggacctctcctccctggagggcgccgacgacgtggaggtgctcgacctccgcgccgcc
aagcgcctcctgctcgccttcgagcgccgcctgcgcgacaacctcgaggcccgcatgaag
caccccgacgaccccgcccgcttcgccgactccgagatcgccctccacgccgagaccgac
cgcctccgcctcctcgccggcgccccggacctcttcccggacctcgtccccctcggcctc
gcctcctccctctcctccctcctcacccacgacaacgccgacctcgccgccgccgctgcc
tccctcctcgccgacctcaccgactccgacgaccccgacgacctcgccggcctccactcc
ctcgccgacgccctcgtcgaagccaacgccctcgacctcctcgtccacaatctctcccgc
ttctccgaggccgaccccgacgaagccgaggctgtccaccacaccctctctgtcgttgaa
aacctcctcgagctccgcccccaactcgccgacattgtctgcgaccgcaccaagcttctc
cgctggctcctcgcccgcctcaaggcccgcgagttcgatgccaacaagcagtacgcctcc
gagatcctcgccatcctcctacaggacagccccgccaaccagaagcgcctgggcaacatc
aatggagtcgacggcctgctgcaggccgttgccatgtacaagtccagggacccaaagacc
tctgatgaggaggagatgctcgagaacctcttcgattgcctctgctgtgtgctcatgccc
atggagaacaaggaaagatttgtcaaggcggagggcgtcgagctcatgatcatcatcatg
aagcagaagaagctggcatacagctctgccatccggaccctcgattttgccatgactagg
ttcccacctgcttgcgagcgctttgttgatgtacttgggctgaagaccgcttttgctgcg
ttcatgggtaagattcctgtgaacaagaaaaacaaaaaagagagttatcaggaagcacta
gaagaacgggtcatttcactaattgcttcattgtttggtggtattacaaaaggttcacga
agaatcaggttactaggaaaatttgttgagaatgaatgtgaaaagatagaccgtttgatg
gagttttacacaaggtattcagaaagagtgaaagctgagactgaaagacttgacagtctt
gatttagatgatctagagatggatgaagatgagcgctacaatcgcaagctagaagctggt
ctttacacacttcagttaattgcacttattctggggcatatatggcactctggcaattca
cagatgagaacaagaatagagttgcttctaagacagaacaaactgactaaggatgacgtt
aaggatatacttgaggagtatcatgacaacattggagatctggatgggcctgaagagaag
gaaagagcgcaagggcggacaaaagagatcatagcatctttatctttgtga

DBGET integrated database retrieval system