KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331295
Entry
4331295           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 9B
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4331295
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4331295
   03400 DNA repair and recombination proteins [BR:osa03400]
    4331295
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     4331295
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4331295
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD Lep_receptor_Ig zinc_ribbon_4 CpXC DNA_RNApol_7kD
Other DBs
NCBI-GeneID: 4331295
NCBI-ProteinID: XP_015629296
UniProt: Q10T38 A0A8J8YLZ7
LinkDB
Position
3:148135..149026
AA seq 114 aa
MSTMKFCRECNNILYPKEEKDRRLLLFACRNCEHQEVSESKCVYRNEVAHAAGERTQVLQ
DVASDPTLPRTKTVRCAACGHGEAVFFQATARGEEGMTLFFVCCNLTCAHRWRE
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagcaccatgaagttttgccgcgagtgcaacaacatcctgtaccctaaggaggagaag
gaccggcggctgctgctgttcgcgtgccggaactgcgagcaccaggaggtatcggagagc
aagtgcgtgtatcggaacgaggtggcgcacgcggccggggagcggacgcaggtgctgcag
gacgtggcgtcggacccgacactgccgcgcacaaagacggtgaggtgcgccgcctgcggg
cacggcgaggccgtcttcttccaggccaccgcccgcggcgaggagggcatgaccctcttc
ttcgtctgctgcaacctcacctgcgcccaccgatggagggaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343902
Entry
4343902           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 9A isoform X1
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4343902
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4343902
   03400 DNA repair and recombination proteins [BR:osa03400]
    4343902
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     4343902
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4343902
SSDB
Motif
Pfam: RNA_POL_M_15KD TFIIS_C Zn_ribbon_recom zf-ribbon_3
Other DBs
NCBI-GeneID: 4343902
NCBI-ProteinID: XP_015647354
UniProt: Q7EZ81 Q8GSD5
LinkDB
Position
7:complement(25369214..25371933)
AA seq 116 aa
MAMSALKFCGECSNMLYPREDKETHTLLYACNSCEHQEPATDTCVYKRVLRKPAGEPKDI
LKDAATDPTLPRTRSIKCYNCGHPEAAFFQAPTKGEKGLTLYFICCNPSCGHRWRD
NT seq 351 nt   +upstreamnt  +downstreamnt
atggccatgagcgccctcaagttctgcggcgaatgcagcaacatgctctacccgcgggag
gacaaggagacgcacaccctgctctacgcctgcaattcctgcgagcaccaggagcctgcc
actgacacttgtgtgtacaaaagggttctccgtaaacctgctggggaacccaaagatatc
ctaaaagatgcagcaactgatcccaccctgcctcgcaccagaagtattaaatgttacaac
tgtggccatccagaggctgctttttttcaggctccaactaagggggagaaaggcctgaca
ctgtacttcatctgctgcaacccaagctgtggtcacaggtggagggattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352511
Entry
4352511           CDS       T01015                                 
Name
(RefSeq) DNA-directed RNA polymerases II, IV and V subunit 9B
  KO
K03017  DNA-directed RNA polymerase II subunit RPB9
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4352511
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4352511
   03400 DNA repair and recombination proteins [BR:osa03400]
    4352511
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     4352511
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      4352511
SSDB
Motif
Pfam: TFIIS_C RNA_POL_M_15KD
Other DBs
NCBI-GeneID: 4352511
NCBI-ProteinID: XP_015618311
UniProt: A0A8J8YKF7 Q2QNM4
LinkDB
Position
12:22946619..22948088
AA seq 114 aa
MSTMKFCRECNNILYPKEDRDQKILLYACRNCDHQEVADNNCVYRNVVHHSAGEFTQVLQ
DVAGDPTLPRTKAVRCAVCGHGEAVFFQATARGEEGMTLFFVCCNPSCGHRWRE
NT seq 345 nt   +upstreamnt  +downstreamnt
atgagtaccatgaaattttgccgcgaatgcaacaacatactgtatcccaaggaggatagg
gaccagaagattctgctctatgcctgcaggaactgtgaccaccaggaggttgcagacaac
aactgcgtctaccggaatgtggtgcaccacagcgccggagagttcacccaagtgctccag
gatgtcgccggcgatccgactctccctcgcaccaaggcggtccggtgcgcggtctgtggc
cacggcgaggccgtgttcttccaggccactgccagaggggaggaagggatgaccctgttc
ttcgtctgctgcaacccgagctgcggtcacagatggagagaatga

DBGET integrated database retrieval system