KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331296
Entry
4331296           CDS       T01015                                 
Name
(RefSeq) CCR4-NOT transcription complex subunit 1 isoform X1
  KO
K12604  CCR4-NOT transcription complex subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331296
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331296
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4331296
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4331296
SSDB
Motif
Pfam: Not1 CNOT1_CAF1_bind CNOT1_TTP_bind DUF3819 CNOT1_HEAT
Other DBs
NCBI-GeneID: 4331296
NCBI-ProteinID: XP_015632082
LinkDB
Position
3:152703..170160
AA seq 2050 aa
MISEISATEVRLLLLQAAADSNLDSVRRRLCQLVDSGLDGCILLLQVCLDQVLLKPHQLD
KSKHDLLSAVFRYCMDKTYFTTCFCEALGPMPATHGDGFLKTLSNVLELSPAERVGIGLA
LSDSEDSGLKLKGQQFSIAQIEGLCLNLLQSPSNDQIHDIVIFLHQTDGLSKHMDTFNTI
ISLFKTKETPFFAPTPFNKCDIQSRHLDMCFGSMDYDSELLLSEIEKEITMADIVTELGY
GCTVDTTHCKEILSIFEPLDDVAVSKLVGAVIGTHNVLVEAHNTYAMFVSAISNMNDSPQ
LTTWNTDVLVDSINELAPSTNWVHVMENLDHEGFNVPDEAAFCLLMSIYAHPCKEPFPLH
AVCGSLWTNTEGQISFLKHAVSVPTDTFTFSHCSRKLAFPDLACPIQDNHAWFCLDLMVV
LCQLAEVGHTVSVQSMLEYPLQHCPELLIVGLGHVNTAYNLLQYEVQSRVFPAILKDATK
SNVVNYLWQINPSLTLRGFVDAHSDPDCLLRIVDVCRDLKILSAVLDSTPYAFSIKLAVA
ASRIDHSHLEKWLIAKLRVCKDDFLQDCVSFLKETMSNASCALEGTIQESQAVVMNIYRE
YCPHFIKILQYQSGHLLSNQKLDELRKSYISYELRNHDSVVRGIPTSDNVEIEADAYFHQ
MFSGQISIAAIVQMLSRFKNSPEKREQLIFKCMISNMFEEYKFLPKYPDKQLKLSALLFG
SLIKHRLVTHLELGIALHAVLDALHKSVDSKMFMFGTTALEQFMDRLIEWPDYCNHILQI
SHLCGAHTEMVSAIERALARISSSQNELSVNISVSSEQHVTGLAPIEPIEASDQPSSLPS
PHQLSSVPSTMHATVFSHPQSSCSGLPRQPSNSTGFGTPLNIGTLVAAAEQRYTSIESPP
SEVQDKIMFMINNISISNMEAKAKECIEVLPECYYPWFAQSMVMKRASIEPKFHDLYLKF
FVKVNSRFLNKEVLKATYENCKILLRSDLIKSSSEERSLLKNLGSWLGKFTIGRNQALLA
KEIDPKVLIVEAYEKGLMIAVIPFTSKILEPCRSSIAYRPPNPWTMGILSLLAEIYNLPN
LKMNLKFEIEVLFKNLDVDLKDVNPTSLLKDRVCEVEGNPDFSNKDVAASQTQISSGISR
STNHVELQSVISSTSHAVSLPNYATPHLPSNSMVEDDNVAFMMPKHVSSHTLTQVSPSET
ALASQSPFSLTQLVKLIPHDEIRCKISSKLGSLGRQLQYSKIMDTALDKAIKEILCPVVE
KSVGTAIQNTKKLILKDYALESDNNTIKSSVHSIARTIAGNLAYANCKEPLCVALTDHLQ
SQIQTLTSNNKTIKQLIDVLINDNLDLGCRIIKSVAMCKAIEMIDEEITESFPLQKKQRE
AAGSAYCDAFTHAQGRFAHEPEALHPKHEHLSVAQQVYEDYVHVWQSHSQHVDASCFGQS
GKATCSSNFIVPRAYSPNSASATSSDCTAAQTAPFIYKLTELLSEELIAEPSSVCPAQVG
LCDSSALHGGPSGVTSTFPPENNFHVMRLFNDWCHTCDHPSSADVAYGRFVMHLQQIGVL
MGDDITERFFHIFTELAVKHSLVPNQIVATGGVSQKSSQQLKISYFPIDSFSKLVAMVLK
YSSAETGPNKCSLLPKILLVAVRIIQRDSEEKKASFNPRPYFRLFISLLYDLISSDLHSD
GANFQVLIAFANAFHALQPLRIPSWSFAWLELVSHRTFMPSLLMCDSRKGWPFFQRLILD
LFKFMEPYLRNVELGEPMCLMYKGTMRVLLILLHDFPEFLCNYHFSFCDMIPSSCIQMRN
VILDAHPQDMRVVDPASPNLKQIDLLPEISMAPQIMSDVEGALKSKLMKTEVDEYFKKSE
GSLFLSDLKQKLLLPQNETSVAGTRYNVPLINSLVLYVGIQGLQQQQTESSASGPAIHTA
HMDIFRTLMADLDTEGRYLVLNAIANQLRYPNIHTHCFYFIILHLFSEATQEIIQDQIMR
VILERLVVRRPHPWGLQMTLVELIKNPRYKLWSRPFIRCGPQIDKVLIEFVDMLDDPRLT
SLYSSFRSIN
NT seq 6153 nt   +upstreamnt  +downstreamnt
atgatctccgaaatctccgcgacggaggtgcgcctcctcctgctccaagccgccgccgat
tctaacctcgattccgttcgccgccgcctctgccagttagtcgactccggtctggatgga
tgcattttgcttctccaagtttgtttggatcaagtgctcctcaaacctcaccagctggac
aaatctaaacatgatcttttatctgccgttttcagatactgtatggataaaacatacttc
accacctgtttttgtgaggctcttggaccgatgcctgccacccatggcgatggcttcctc
aaaaccttatcaaatgtcctggaactctcaccagctgagagagttggcattggacttgcc
ctgtcagattctgaggattcaggcctcaagctcaaagggcaacagttttcaattgctcaa
attgaggggttgtgtttaaatcttcttcaatcgccatcaaatgaccaaattcacgacatt
gtcatctttcttcaccagactgatgggctgtcaaagcatatggatacttttaataccatt
atatctctattcaaaaccaaagagacaccgttttttgctcctaccccatttaacaagtgc
gatattcagtcaaggcatctggacatgtgctttggcagcatggattacgattctgagttg
cttctgtctgaaattgagaaagaaattaccatggcagacatcgtaactgagttgggttat
ggatgcacagttgataccactcattgtaaggaaattctttccatattcgagcctcttgat
gatgtagcagtatcaaagttggttggggcagttattggcactcataatgtccttgtggag
gcccacaatacatatgctatgtttgtatcggctattagcaacatgaatgattcacctcaa
ttgactacatggaacactgacgttcttgtggattcgatcaatgaacttgcccctagcact
aactgggtgcatgtaatggaaaatcttgatcatgagggtttcaatgttcctgatgaagca
gccttttgtttgctgatgtctatatatgcccatccttgcaaggagccttttccacttcat
gctgtttgtgggtcattgtggacgaatacagagggtcaaatttcattcttaaagcatgca
gtttccgttcctactgatacatttacattttcgcattgttcgaggaagctggcatttccg
gacttggcctgtcctattcaagacaatcatgcttggttctgccttgaccttatggtggtt
ttatgccaacttgctgaagttggacacaccgtgtcagtacaatcaatgctggagtatcct
ctacaacattgtcctgaactcttaattgttggtcttggacacgttaatactgcgtataat
ctcctccaatatgaagtgcagtctcgtgtatttcctgccatactgaaggatgctacaaaa
agcaatgtggtgaactatctctggcagattaacccatccctcactcttcgaggatttgtt
gatgctcattctgatccagattgtcttctgaggattgttgatgtgtgtcgagacctgaag
atcctatctgctgtgcttgattctaccccttatgcattcagcattaaactggctgttgct
gcctctaggatagaccatagccatcttgagaaatggttgattgcaaagttacgtgtctgc
aaagacgattttcttcaggattgtgttagtttcttgaaagaaactatgagcaatgcatct
tgtgctctagaaggtacaattcaagaatctcaagctgttgttatgaatatatatcgggag
tattgtcctcactttataaagattcttcagtatcagtcagggcatctcttgtccaatcaa
aaattggatgaactaagaaaatcatatatttcttatgagttgagaaatcatgattctgtt
gtaagggggatccctacttcagataatgttgaaatagaggcagatgcttattttcaccag
atgttttctggacagataagcattgctgcaattgtacagatgctatctcgcttcaaaaat
tctccagaaaaaagggagcaattgatttttaagtgtatgatatcaaatatgtttgaagaa
tacaagttcctcccgaagtatcctgataagcagcttaaactgtcagctcttttgtttgga
tctcttattaagcatcgacttgtgacccaccttgagctcggaattgctctacatgctgtt
cttgatgccttgcacaaatctgttgattcaaagatgtttatgtttggcacaacagcattg
gaacagtttatggaccgtcttatagagtggccagactactgcaatcatatattgcagatt
tcccatctttgtggggcacacactgaaatggtctcagcaattgagagagcccttgctagg
atctcatcgagccagaatgagctcagcgttaacatctcagtctcttctgagcagcatgtc
actggtttggcaccgattgaaccaatagaggcttctgatcaaccatcttcattaccttcc
cctcatcaattgtccagtgtgccatctactatgcatgctactgttttttcacatcctcaa
agttcctgctcagggttgcctcgacagccttccaattctacaggatttggaactccttta
aatattgggacacttgtagcagcagcagagcaaagatacacatccattgagtctcctcca
tctgaagttcaggacaagatcatgtttatgattaataatatatcaatctcaaatatggag
gctaaggcaaaagaatgtattgaggtactcccagaatgttattatccttggtttgcacaa
tccatggtcatgaaaagggcaagcattgaaccaaaatttcatgacttgtatttgaagttc
tttgtcaaagtgaactcaagattcttaaacaaagaagtactgaaggctacatatgagaac
tgcaagatattgttaagatcggatcttatcaaatctagttctgaggaacgctccttgcta
aaaaatctgggaagctggctaggaaaattcaccatcgggaggaaccaggcattactagct
aaggaaattgacccaaaagttcttattgtagaggcatatgagaaaggactgatgatagca
gtcattccattcacttcaaagattcttgaaccttgccggtcaagtatagcataccgtcct
ccaaatccctggacaatggggattcttagtctgcttgctgagatctataatctaccaaac
ctcaagatgaatctaaaatttgagattgaggttctgtttaagaaccttgatgtggatctg
aaagatgtaaacccaacttccctccttaaggatagagtatgtgaagttgagggaaatcca
gatttttcaaacaaagatgttgctgcatctcaaacccaaatctcttcgggcatcagtcgc
tcaacaaaccatgtggaactgcagtcagttatcagtagcacttcccatgctgtgagcctt
ccaaattatgcaactcctcatcttccttcaaatagcatggtagaagatgacaatgttgct
ttcatgatgcctaagcatgtttcctcgcatactttgacccaggtttcaccatcagaaaca
gcattggcatcacaatctccattttctcttactcagcttgtgaaattgataccacatgat
gagatacgctgcaaaataagttcgaaacttggctctcttggtcgacaattgcaatacagc
aaaatcatggacacagctttggacaaggctattaaagagatattgtgccctgttgttgaa
aaaagtgtgggcacagcaatccaaaatacaaaaaaacttattctgaaggattatgcactg
gagtcagataacaataccataaaatcttctgtacattcaatagccaggacaatagctgga
aatctagcctatgctaattgcaaggaacctctttgtgttgcactaacagatcatcttcaa
agtcagattcagacgctcactagtaacaacaaaactatcaagcaactaatcgatgttcta
atcaatgataacctggatcttggctgcagaattattaagtctgttgcaatgtgcaaggct
attgaaatgattgacgaagaaataacagagtcttttccactacaaaagaaacaaagggag
gcagctggctctgcatactgtgatgcttttacccatgctcagggtcgatttgcacatgaa
cctgaagcactgcatcctaaacatgagcatctatctgttgcccaacaagtgtacgaggac
tatgttcatgtatggcagagccatagccaacatgttgacgcttcatgttttggtcagtct
ggtaaagctacttgctcaagcaattttattgtacctcgagcatacagtccaaattcagca
tcagcgacctccagtgattgtactgctgctcaaactgcgccatttatatataaattgaca
gaactgttgtctgaggaattgatcgcagaaccttcgagtgtttgtcctgctcaagttggt
ctctgtgactcttctgctctacatggtggacccagtggtgttacatcaacttttcctcca
gagaacaattttcatgttatgcgcctatttaatgactggtgccatacatgtgatcatcca
agttctgctgatgtggcatatggccgttttgttatgcatctgcaacagattggcgtgttg
atgggagatgatattactgagcgcttcttccatattttcaccgaacttgctgttaaacac
tctctagtccccaatcagattgttgctactggtggagtgtctcagaagtcatcacaacaa
ctcaaaatttcatatttcccaattgattctttttcgaagcttgtagctatggtgctcaag
tactcatctgctgaaacaggaccaaataaatgcagccttcttcccaagattttgttagtg
gcagttaggatcattcagagagattctgaagagaagaaagcatcattcaatccccggcca
tactttcggctttttataagtttgctatatgatcttatttcttctgacctccatagtgat
ggtgctaatttccaggttttgattgcatttgcaaatgcattccatgcactgcaacccttg
agaattccttcctggagctttgcttggcttgagttggtgagtcacagaactttcatgcca
agtctgttgatgtgcgattcgagaaaagggtggcctttctttcagcgtctaattcttgat
ctgttcaaattcatggagccatatttgagaaatgttgaacttggagaaccaatgtgtctt
atgtacaaaggaactatgagggtgctacttatactactgcatgactttcctgaatttctg
tgcaattaccacttcagtttctgtgacatgattccttccagttgcattcaaatgcgcaat
gtcattcttgatgctcatccacaagacatgagagtggtagatccagctagtcctaatttg
aagcagattgatctgttaccggaaatttcaatggctccacaaatcatgtcggatgttgag
ggtgctctgaaatcaaagctgatgaagactgaggttgatgagtacttcaagaaatcagaa
ggctctttgtttcttagtgatctgaagcaaaagttattgctgccacaaaatgaaactagt
gttgccgggacacgctacaatgttcctctcattaattcgcttgttctctatgtcggtatc
caaggtttgcaacagcaacaaacggagtctagtgcatctggtccagcaatccatactgcc
cacatggatattttcagaactcttatggcagacttggacacagagggccggtaccttgtt
ttgaatgcaatagctaaccagctgcgttaccctaatatccatacacactgcttctacttc
atcatcctgcatctgttttcagaagctacccaggaaattatccaggatcagataatgagg
gttatcttggaacgtctagtagtgagacgtcctcatccttggggcttacaaatgactttg
gttgaactgattaagaatccacgttacaagctgtggagccgaccttttatacgctgtgga
ccacagattgacaaggtgctgatcgagtttgttgatatgttggatgacccgagattgacc
tctttatactcgtcttttcgctcaattaattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272729
Entry
9272729           CDS       T01015                                 
Name
(RefSeq) CCR4-NOT transcription complex subunit 1
  KO
K12604  CCR4-NOT transcription complex subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9272729
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9272729
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     9272729
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     9272729
SSDB
Motif
Pfam: Not1 CNOT1_CAF1_bind CNOT1_TTP_bind DUF3819 CNOT1_HEAT CSM2
Other DBs
NCBI-GeneID: 9272729
NCBI-ProteinID: XP_015614203
LinkDB
Position
10:complement(21884562..21903712)
AA seq 2413 aa
MIPFNSAVAEDVRSLVQGVDDSTFDSTHRELCQLADCSPDGCSLLLQVCLDEVLLNADVA
KSSRLKPELLSTVFKYCLDKPYFSTSFCEALKTVHVSDMFLVKLSNELNLSAGERVGVGL
ALSDSGNLGLITKGQKFSIAEIEEICANPAHVLTNDQIHDIVVFLHQTDGLSKHMDSFTN
IISLLNVKEMPFYVPAPIKEGNARPTISSRHMELYTGSLDDDFDSLLSEIGKEISMADII
TELGYGCTSDIAHCKEILSLFEPLDDMGISKLLGAVVCTHVGLGEAHNTYSTFMSAVGNS
QPSDSSQFTAWNIDVLVDSINEIAPRTNWITVVENLDHEGFCIPDEAAFCLLMSIYSRAC
KDPFPLHAVCGSLWKNTEGQLSFLKHAVAAPTDTFTFKHCSRKMVFPEFANRMQGNQAWY
CLDLLEVLCQLAELGYATMVRSMLDYPLIHCPDVLLLGVSHINTPYNLLQYEVLSCVFPM
ILKDTTYSSLMNSLWHVNPYLTLRGFVDSHSDANCLLRTVEICQDLTILSAVLDSTPFAF
SIKLATVAFRQSHSNLEKWLVEKLTAQGETFLEECVKFLKEIMSNTTYEAAEGAVQQPQV
MILDICRESCPLIIKVLQSHSGQLLSNQLVEELRRVEAVHESRNHGVVGRDAPTSEGGPD
DIEAQANIYFHQMFSGQISVDAMVQMLARFKESTNKRELSIFNCMVSNLFEEYKFFPKYP
DTQLKLAAVLMGSLIKHQLVAHLGLGIALRSVLDALRKSIDSKMFMFGTTALEQFMDRLI
EWPQYCNHILQISHLRATHAELVAAIERVLAKISSSQNEPNVGSMLSADQHGSSSIGNME
ASEASWQLINPTPTQLERSHQQRHQGFLGERSKGSTNIIQAKNILSSGQMPLASSPGDLA
VNLKAATTPSSQASPHHSTTVSAPLQPTGFLRSRSSAPSGIRQPSFTTGFGAALNIETLV
AAAERRDTPIEAPPSEVQDKIFFMINNISTSNMEAKAREFNEVLQEQYYPWFAQYMVMKR
ASIEPNFHDLYLKFFDKVNSKSLNKEMVKATYENCKVLLQSDLIKSSSEERSLLKNLGSW
LGKFTIGRNQTLRAKEIDPKILIIEAYERGLMIAIIPFTSKILEPCQSSIAYRPPNPWTM
GILSLLVEIYNLPNLKMNLKFDIEVLFKNLSVDMKDVKPSSLLKDRIRQIEGNPDFSNKD
VSASQAPVVAEVSSGVMPTINHVEPQPEINSTSRATSLPNMLSQYAAPLRLPTNNMVEDD
KSALIMPEQVSSLGLSQVSPSQTPSLSSSSFSLSQLIAAIPRADIYFRINEKLSSFGSLQ
YSKIMDMALDKAIKEIIGPVIQRSVTIASRTTKELILKDYAMEADDSAVSRSAHLMVGTL
AGSLAHVTSKEPLRVALSSHLRSLIQGITNNTESTEQIMLILVNDNLDLGCALIETVATR
KAVEMIDGEIKQPFSQLRRQKELLGSAYYDAFPYTQGLKRVPDALRPKPTGHLSAAQRRV
YEDFITVWHSQSSQNAGGSATATAMAVAPSNSSVPRVYSPNSALTDSSSFSSHFASASQT
TELVHEESDRNAHLSSLSSKIGASDTSTQVIGTTNVASVFPPMVPNDLPVGEPTTTNKDL
VTSAPLSPTTAVDRMGSVFVEPLNTSDALEMYQQVSQKLDTLIAKDGKDAEIQSVIAEVP
DILLRCVSRDEAALAIAQKVFRSLYDNASNSNYVTWLLAALVAIRDVCKLVVKELTSWVI
YSDEDKKFNIDIIIGLIRSELINLGDYNVHLAKIIDGGRNKAATEFAISLVQTLITQESI
SIAEVYNVVDALSKLAIRPSSPESLQQLIEIARSFASVKDENIRQSRDKKVLSGRPLVNK
EENNANDVAFTDAVGFQEKVAVSFSEWCNICDHPTMGDSAYTHYIVKLQQDGLLKGDDLT
DRFYHILTELAVAHSVVSEQVVAPGGISQQPTQQLQISYFSIDSYSKLVALVVKYSSVDI
GPSKGSLFNKILSVIVRIIQRDAEEKKVSFNPRPYFRLFINLLSELTTSDLHHDSANFQV
LTAFANAFHVLQPLRVPAWSFAWLELVSHRSFMPKLLLCNAQKGWPFFQRLLVDLFKFME
PYLRNAELGQPIHLLYKGTLRVLLVLLHDFPEFLCDYHFSFCDVIPPSCIQMRNVILSAF
PRNMRLPDPSTPNLKIDLLAEISIPPRIMSDVDGALKSKQMKTQVDEYLKRPDGSFLTDL
KQKLLLPQNEANIAGTRYNVPLVNSLVLYVGMQAVQQLQLNKMNASASAQQMNQSQLDVQ
IETATELFRNLVMNSDTEGRYLLLNAIANQLRYPNNHTHYFSFIILYLFSEANQEIVQEQ
ITRVLLERLIVNRPHPWGLLITFIELIKNPRYSFWARSFTRCAPEIEKLFESVARSCGGK
GGDDGVGLPDGGH
NT seq 7242 nt   +upstreamnt  +downstreamnt
atgatccccttcaattccgccgtagccgaggatgtccgctccctggtgcagggcgtggac
gactccaccttcgactccacccaccgcgagctctgccagctagcggactgcagtcctgat
ggatgcagtttgctgcttcaagtttgtttggatgaagtgctgctgaatgccgacgtggca
aagagctctcgattgaaacctgagctcttatcaactgttttcaagtattgtctggataaa
ccatacttcagcaccagtttttgtgaagcactgaagacagtacatgtcagtgatatgttc
cttgtaaaattgtcaaatgaacttaatctatctgctggagagagggttggagttgggctt
gccctatcagattctggaaatctaggcttgattacgaaagggcaaaagttctcaatcgct
gaaatcgaggagatatgtgcaaatccagcccatgttttaacaaatgatcaaattcacgat
attgttgtgtttcttcaccagactgatggcctctcaaagcatatggattctttcactaac
atcatctccctattaaatgtcaaagagatgccattctatgttcctgccccaattaaggaa
ggcaacgctcggccaacaatttcttcaaggcacatggaactatacactggtagcttggat
gatgattttgattcccttctatctgaaattgggaaagaaataagcatggctgacatcatt
actgaattaggctacgggtgtacttcagatattgctcattgtaaagaaatactgtcacta
tttgagcctcttgatgatatgggaatctctaagttgcttggagcagttgtttgcactcat
gttggtcttggtgaagctcataatacatattcaacgttcatgtcggccgttggcaacagc
caaccaagtgactcatctcaatttactgcatggaatattgatgttctcgtggattcaatt
aatgaaattgccccaagaactaattggattactgtagtggaaaatcttgatcatgagggt
ttctgtatccctgatgaagcggcattttgtttgctgatgtctatatattctcgggcctgc
aaggatccatttcctcttcatgctgtctgtgggtcactgtggaagaatacagaaggacaa
ttatcattcttgaaacatgcggtggctgcgccaactgatacatttacattcaaacattgt
tccaggaagatggtatttccagaatttgctaaccgcatgcaaggcaatcaggcttggtac
tgcctggaccttctagaggttttatgccaacttgctgaacttggctatgcaacaatggtt
cggtcaatgcttgactacccactgattcattgccctgatgttttacttcttggtgttagc
cacatcaatactccatataatctcctccagtatgaagtattgtcttgtgttttccctatg
atactgaaggacactacatacagtagtcttatgaactctctctggcatgtcaacccttac
ctcactcttcgtggatttgttgattcacattccgacgcaaattgccttctcagaactgtt
gagatatgtcaagacctaacgatcctatccgcagtccttgattccaccccgtttgcattt
agcatcaagcttgctacagttgcttttaggcaaagtcatagcaatcttgagaaatggttg
gttgaaaagctgactgctcaaggagagacttttcttgaggaatgtgtgaaattcttgaag
gaaattatgagcaacacaacttatgaggctgcagaaggtgctgtccaacaacctcaagtg
atgattttggatatttgccgagaatcttgccctctaattataaaggttctgcaatctcac
tcgggccagctgttatctaaccaacttgtggaggaactaaggagagtggaagcagtgcat
gaatcaaggaatcatggtgttgtaggaagggatgcccctacttctgagggaggtcctgac
gacattgaagcacaggcaaatatatattttcaccagatgttttctggacagataagcgtt
gatgctatggtacaaatgcttgcacgtttcaaagaatctacaaacaagagggagctatca
attttcaattgcatggtttcaaatttgttcgaggagtacaaattcttcccaaagtatcca
gatacacaacttaagttagcagctgtgctcatgggatctctcattaagcatcaacttgtg
gctcacctgggacttggaattgctctacgtagtgttcttgatgccttgcgtaaatctatc
gattcaaagatgtttatgttcggaacaacagcgctagagcagtttatggatcgtctaatc
gagtggccacagtactgtaaccatatattgcagatatcacatcttcgtgcaacacatgcc
gaattagttgctgcaattgaacgagtgctcgccaagatatcgtcaagtcaaaatgagcca
aatgtaggcagcatgctttctgcagatcagcatggttcatcatctattggaaatatggag
gcttctgaagcatcgtggcagctcatcaatccaactccaacacaacttgaacggtcacac
caacagaggcaccagggtttccttggggagaggtccaagggctctacaaacatcattcaa
gccaaaaacattctttctagtgggcaaatgccacttgcttcatcacctggtgatttggct
gtcaatctaaaggctgccacaacaccatcgtcacaagcttctcctcatcattctaccact
gtatcagctcctttacaacccactggctttctgcggtctagaagttctgctccttcaggc
attcgacaaccttccttcaccacaggatttggagctgctctgaatattgaaactctagtt
gccgctgcagaaagaagagatacaccgattgaggcccctccttctgaagttcaagacaag
attttcttcatgatcaataatatttccacttccaatatggaggctaaggcaagagaattt
aacgaggttttgcaagaacagtattatccctggtttgcgcaatatatggtcatgaaaagg
gcaagcattgaaccaaattttcatgatttatacttgaagtttttcgacaaagtcaactca
aaatcattgaataaggaaatggttaaagctacatatgagaactgcaaggtcttattacag
tccgatctcataaaatctagttcggaagaacgttcattgcttaaaaatcttggtagttgg
ctaggaaaattcactataggaaggaatcaaacattacgagcaaaggaaattgatcccaaa
attcttattatagaggcatatgaaaggggtttgatgattgctattataccattcacatca
aagattcttgaaccttgccagtcgagtatagcataccgtcctccaaatccttggacaatg
ggtattcttagccttctcgttgagatctataatctacctaatctcaagatgaacctgaag
tttgacattgaggtcttgtttaagaatctaagtgttgatatgaaagatgtgaaaccatct
tctcttctgaaagaccgtattcggcaaatagagggaaatccagatttttcaaataaagat
gttagtgcatctcaagcaccagtagttgctgaggtttcctctggcgtcatgcctacaata
aaccatgtggaaccacaaccagagataaatagcacttcccgtgctacaagccttccaaat
atgttgagtcagtatgcagcacctcttcgccttcctacaaacaatatggtagaagatgac
aagtccgctttaatcatgcctgaacaggtttcctctcttggtttgagccaggtttcgcca
tcacaaacaccatcactatcatcgtcttcattttctcttagccagcttattgcggcaatt
ccacgtgcagatatatatttcagaattaatgaaaagcttagctcttttggctcgttgcag
tatagcaaaatcatggatatggctttggataaggccatcaaagagattataggtcctgtc
attcaaagaagtgttacaatagcgagccgaacaactaaggaacttattctaaaggattat
gcaatggaagcggatgatagtgccgtatctcgttctgcacatttgatggtcggtacacta
gctggaagtcttgcccatgttacatccaaggaacctcttcgtgttgctttatcatctcat
cttcgtagtcttattcagggcataactaataatactgaatccacagagcagattatgctt
attcttgtcaatgataatctggatcttggatgtgccctaatagagaccgttgcaacacgc
aaggctgttgagatgatcgatggggaaatcaagcagcccttttcacaactaaggagacaa
aaagaactacttggatctgcatattatgatgcttttccttacactcaaggtcttaagcgt
gttccggatgctcttcgtcctaagcctactggccatttatctgctgcccaacgacgagtg
tatgaggacttcattactgtatggcacagtcagagtagtcaaaatgcgggtggttcagct
actgctacagcgatggcggtcgctccaagcaattccagtgtacctcgagtttacagtcca
aattcagcactgacagactccagtagcttttcctcccattttgcatctgcaagtcagact
acagaactggtacatgaagaatcagatcgcaatgcacacctttcaagcctttcttcaaaa
attggcgcgagtgacacatctacccaagttattggaaccacaaatgttgcatctgttttt
ccgcctatggttcccaatgaccttccagtgggtgaaccaacaaccacgaataaagatctt
gttacttcggcaccactttcacctacaactgctgttgatcggatgggatctgtttttgtg
gaacctttgaatactagtgatgcgctggagatgtaccaacaagtttcacaaaagctggat
actttgatcgcaaaggatggcaaagatgcagaaattcagtctgtcattgcggaggttccc
gacatcttactcagatgtgtcagtcgagatgaagctgccttggctattgcacagaaggtt
ttcagaagtttgtatgacaatgcatcaaacagtaattatgtcacatggctcctagcagct
ttggtcgcaatacgtgatgtttgcaaacttgtcgtcaaggagttaacgagctgggtaata
tattctgacgaagataagaagtttaacatcgacataattattggactaattcggtctgaa
ctgattaatcttggggattacaatgttcatttggcgaagattattgatggcggaagaaac
aaggctgcaaccgagtttgctatatcacttgtccagacattgattacccaagaatctatt
agcatcgcagaggtttataatgttgttgatgccttatcaaaacttgcaatcaggcccagt
tctcctgaatcgctgcagcagttgattgaaatcgctagaagttttgcttccgtgaaggat
gaaaatattagacagtcaagggataaaaaggttttatccggtcgtcctttggtgaataaa
gaggaaaataatgctaatgatgttgcgttcactgatgctgttggttttcaggagaaggtc
gcagtatcattctctgaatggtgtaatatatgcgatcatcccactatgggtgattcagca
tacactcattacattgtgaagctgcaacaggatggcttgctaaagggagatgatttgacc
gaccgcttttaccatattctcacggaacttgctgtggcacactctgtagtctctgagcaa
gtagttgctcctggcgggatttctcagcagccaacgcagcaactccagatttcatacttc
tcaattgattcatattcaaagcttgtggcactggtggtaaagtactcttctgtggatatt
ggaccgagtaaaggaagcctttttaataagattctttctgttatagttaggattattcaa
agagatgctgaagaaaagaaagtttctttcaatcctcggccgtattttcggttgttcata
aatttgcttagtgagcttactacttctgaccttcaccatgatagtgctaattttcaggtg
ttgacagcatttgccaatgcattccatgtgcttcaacccttgagagttcctgcatggagt
tttgcttggcttgaattggtaagccacagaagcttcatgccaaagctattgctgtgcaat
gcacagaagggctggccattcttccagaggttgcttgtcgatttgttcaaattcatggaa
ccatatttaagaaatgctgaactgggacaacccatacacctgttgtacaaaggaactttg
agagtgttacttgtgctactgcatgacttccctgagttcctttgcgattaccacttcagt
ttctgtgatgtcattccccccagctgcattcaaatgcgcaatgttattcttagtgctttt
ccacgcaatatgagacttccagatccctctactccaaatttaaagattgatcttcttgct
gagatttcaattcctccaagaatcatgtctgatgttgatggtgccttaaagtcaaagcaa
atgaagacacaggttgatgagtacctcaagaggccagatggatcctttttaactgattta
aagcagaagttacttctgccgcaaaacgaagcaaatattgctgggactcgttacaatgta
cctcttgttaattcacttgtgctctatgtgggcatgcaggctgtgcaacagttgcagctt
aataaaatgaatgcatcagcgtcggcgcagcaaatgaaccaaagtcaactggatgtccag
attgagacagctacagagctcttcagaaatcttgtaatgaattcggatacagaaggtcgc
tacctcctcctcaatgcgattgccaaccagctgcgctatccaaacaaccacacacactat
ttttccttcataattctttacttgttttctgaggcaaaccaggaaatagtccaggagcaa
ataactagggtacttctggaacggctaatagttaaccgccctcacccgtgggggctacta
attactttcattgagcttataaagaatccacgctacagtttttgggctcgatcatttact
cgctgtgcacctgagatcgagaagctgttcgagtctgttgcaaggtcttgtggaggaaaa
gggggagacgatggagttggtctccccgatggtggccattaa

DBGET integrated database retrieval system