KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331346
Entry
4331346           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S17-3
  KO
K02962  small subunit ribosomal protein S17e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331346
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331346
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4331346
  Archaea
    4331346
SSDB
Motif
Pfam: Ribosomal_S17e
Other DBs
NCBI-GeneID: 4331346
NCBI-ProteinID: XP_015628905
UniProt: Q8H7V0 A0A0P0VS16
LinkDB
Position
3:complement(559227..559943)
AA seq 144 aa
MGRVRTKTVKKTSRQVIEKYYSRMTLDFHTNKKVLEEVSILPSKRLRNKVAGFSTHLMRR
IQRGPVRGISLKLQEEERERRMDFVPDRSALEVDDIRVDKETLDMLTSLGMADLPGVVRQ
PDASTSAPQQYGAARLPYARRDRA
NT seq 435 nt   +upstreamnt  +downstreamnt
atggggcgcgtgcgcacgaagacggtgaagaagacgtctcggcaggtgatcgagaagtac
tactcgcggatgaccctggacttccacacgaacaagaaggtgctggaggaggtgtcgatc
ctgccgtcgaagcgcctccgcaacaaggtggccggcttcagcacccacctgatgcgccgc
atccagcgcggccccgtccgcggcatctccctcaagctccaggaggaggagcgcgagcgc
cgcatggacttcgtcccggacaggtcggcgctcgaggtcgacgacatccgcgtcgacaag
gagaccctcgacatgctcacctccctcggcatggccgacctccccggcgtcgtgcgccag
cccgacgcctccacctccgccccgcagcagtacggcgccgcccgcctcccctacgcccgc
cgcgaccgcgcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348608
Entry
4348608           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S17-3
  KO
K02962  small subunit ribosomal protein S17e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348608
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4348608
  Archaea
    4348608
SSDB
Motif
Pfam: Ribosomal_S17e BBL5
Other DBs
NCBI-GeneID: 4348608
NCBI-ProteinID: XP_015614780
UniProt: Q7XEQ3 Q0IXR6
LinkDB
Position
10:14330679..14331457
AA seq 141 aa
MGRVRTKTVKKTSRQVIEKYYSRMTLDFHTNKKVLEEVSILPSKRLRNKVAGFTTHLMRR
IQRGPVRGISLKLQEEERERRMDFVPEKSALEVEEIRVDKETMEMLAALGMADLPGVERQ
QEVSAPTYSRPPYGGPRRDRV
NT seq 426 nt   +upstreamnt  +downstreamnt
atgggtcgcgtgcggaccaagacggtgaagaagacctcgaggcaggtgatcgagaagtac
tactcgcggatgacgctcgacttccacaccaacaagaaggtgctcgaggaggtgtccatc
ctgccgtcgaagcggctgcgcaacaaggtggccgggttcaccacccacctgatgcgccgc
atccagcgcgggcccgtgcggggcatctcgctgaagctgcaggaggaggagcgcgagcgc
cgcatggacttcgtcccggagaagtcggcgctcgaggtggaggagatccgcgtcgacaag
gagaccatggagatgctcgccgcgctcggcatggccgacctccccggcgtcgagcgccag
caagaggtctccgcgccgacctactcccgcccgccgtacggtggcccccgccgcgaccgc
gtctag

DBGET integrated database retrieval system