KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331360
Entry
4331360           CDS       T01015                                 
Name
(RefSeq) folylpolyglutamate synthase isoform X1
  KO
K01930  folylpolyglutamate synthase [EC:6.3.2.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4331360
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.17  tetrahydrofolate synthase
     4331360
SSDB
Motif
Pfam: Mur_ligase_M
Other DBs
NCBI-GeneID: 4331360
NCBI-ProteinID: XP_015630995
UniProt: Q10SU1 Q0DVV3
LinkDB
Position
3:complement(640609..645670)
AA seq 554 aa
MPHRPHLAQLRRLLLLPCSSVPVPVPARRLSSPRAMASSSVSAAAAAAQAGGAVAAAEYE
DVMGRLSSLITQKVRAHSGNRGNQWDLMAHYLQILELEEPIARMKVIHVAGTKGKGSTCT
FTEAILRSCGFSTGLFTSPHLMDVRERFRLNGVDISEEKFLKYFWWCWNKLKEKTDDDIP
MPTYFRFLALLAFKIFSAEQVDVAVLEVGLGGKFDATNVVEAPVVCGIASLGYDHMEILG
NTLGEIAGEKAGIFKKGVPAYTAPQPEEAMIALKQRASELGVSLQVAHPLEPHQLKDQHL
GLRGEHQYVNAGLAVALASTWLEKQGHVERIPLNRTDPLPDQFISGLSNASLQGRAQIIT
DSQVNSGEEDKDCSLVFYLDGAHSPESMEICARWFSHVTKEDRTVPSSMVQSQSCGNSQK
ILLFNCMSVRDPMRLLPHLLDTSTQNGVHFEMALFVPNQSQYNKLGTNSSAPAEPEQIDL
SWQLSLQRVWQKLLHGDKGMNNTNSSENSLVFESLPLAMEWLRTNARQNRSTSFQVLVTG
SLHLVGDVLRLVKK
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgcctcaccgccctcacctggctcagctccgccgcctcctcctcctgccttgctcctcc
gtccccgtccccgtccccgcccgccgcctctcctcccctcgcgccatggcctcctcctcc
gtctccgccgccgccgccgccgcgcaggcaggtggtgctgtggcggcagcggagtacgag
gacgtgatggggcggctctcctcgctcatcacgcagaaggtgcgggcgcacagcggcaac
cggggaaaccagtgggacctcatggcgcattacctccagattctggagctggaggagccg
atcgcgcggatgaaggtgattcacgttgccgggaccaaaggaaagggttcaacatgcaca
ttcacagaggcaatcctgcgatcatgtggtttcagcacagggctgttcacctcaccacat
ttgatggatgtcagggagcgattccggctaaatggggtggatatttccgaagaaaagttt
ttgaaatacttctggtggtgctggaataagctcaaggagaagactgatgatgatattccc
atgccaacctacttcagattccttgcattgttagcattcaagatattctcagctgaacag
gttgatgttgctgttctcgaggttggccttggagggaagtttgatgcaactaatgtggtt
gaagcacctgtggtttgtggaatagcttcccttggatacgaccatatggaaattcttgga
aacacacttggagaaattgctggtgagaaggcagggattttcaagaagggagttccggcc
tacactgctccacagccagaagaggcaatgattgctctgaaacaaagggcttcagaattg
ggtgtttcactccaagttgcacatcctttggaaccccatcaattaaaggatcaacatctt
ggactgcgtggtgaacaccaatatgtaaatgctggccttgcagttgcattggctagtaca
tggcttgagaagcaaggacatgtggaaagaataccactgaaccgaactgacccgttacca
gatcagtttattagtgggctgtcaaatgcctctttgcaaggccgagcgcagatcattaca
gattcacaagtaaactcaggagaggaagataaagactgttctttggttttctatttggat
ggggctcacagtcctgaaagtatggaaatttgtgctagatggtttagccatgtcactaaa
gaggataggacagtaccatcttccatggtgcagtctcagtcttgtggcaactctcaaaag
attcttctattcaattgcatgtccgtgagggatcctatgaggttgcttccgcatcttctg
gatacatcaactcaaaatggggtccactttgagatggctctttttgtgccaaaccaatca
caatacaacaagcttggtaccaattcatcagctcctgcagagcctgagcaaattgatttg
tcatggcaattgtcgcttcaaagagtgtggcagaaattacttcatggtgataaaggtatg
aacaacacaaattccagtgagaacagtctggtttttgaatcacttccactggcaatggag
tggctgaggacaaatgcccgacaaaaccgatcaacttcttttcaggtcctggttactggc
tccctgcatctcgttggtgatgtgttgagattggtcaagaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349049
Entry
4349049           CDS       T01015                                 
Name
(RefSeq) folylpolyglutamate synthase isoform X1
  KO
K01930  folylpolyglutamate synthase [EC:6.3.2.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4349049
Enzymes [BR:osa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.17  tetrahydrofolate synthase
     4349049
SSDB
Motif
Pfam: Mur_ligase_M
Other DBs
NCBI-GeneID: 4349049
NCBI-ProteinID: XP_015612754
LinkDB
Position
10:complement(19201582..19206781)
AA seq 596 aa
MRASGAASPPPSSATTTTTTTTLLVPSSSVAMPPPRLAHLRRRSSSLLLLHHNHHHHRGG
GSAPPHPLLRPPPPPQSHPFQLLTPRAAMASVAQPGVAAGSAEYEEVLGCISSLITQKVR
ADTGNRGNQWELMAKYLQILELEEPIARLKVVHVAGTKGKGSTCTFAESILRSCGFRTGL
FTSPHLMDVRERFRLNGLDISEEKFIRYFWWCWNKLKDKTGGDIPMPAYFRFLALLAFKI
FSDEQVDVAVLEVGLGGKYDATNVVKAPVVCGISSLGYDHMEILGNTLGEIAGEKAGILK
KGVPAYTVPQPEEAMSVLKHRASELGVPLQVVQPLDPQQLDDQPLGLHGEHQYMNAGLAV
ALVNTWLQRQGHFNILHKKHSVTLPDQFIEGLSSACLQGRAQIVPDPEVLSKDSSSLIFY
LDGAHSPESMEICAKWFSCVTRKDEQQPGPLDQLHIGTNSRKILLFNCMSVRDPQRLLPC
LLATCAQNGLQFDHALFVPNQSQYNKLGSHASPPSERVQIDLSWQLSLQRVWEGLLHSNK
GLNGSNSSTASSVFESLPLAIKWLRETAQQNQSTSYQVLVTGSLHLVGDVLRLLKE
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgcgcgcgagcggcgccgcgagcccaccaccatcctccgccaccaccaccaccaccacc
accacgctactagtaccctcctcctccgtcgccatgccgccccctcgcctcgcccacctc
cgccgccgcagcagcagcctcctcctcctccaccacaaccaccaccaccaccgcggcggc
ggcagcgcccctccccaccctctcctgcgcccgccgccgccgccgcagtcccaccccttc
cagctcctcaccccgcgcgccgccatggccagcgtcgcgcagccaggagtcgcggcgggg
tcggcggagtacgaggaggtgctggggtgcatctcgtcgctgatcacgcagaaggtgcgg
gcggacaccggcaaccgtgggaaccagtgggagctcatggccaagtacctgcagatactg
gagctggaggagccgatcgcgcggttgaaggtggttcatgtcgcagggacgaaagggaag
ggttcaacatgcacatttgccgagtcaattcttcgatcatgtggtttccgcactgggttg
ttcacctcaccacacttgatggatgttcgtgagagatttcggcttaacgggttggacatt
tcggaagaaaagtttataaggtatttctggtggtgctggaacaaactgaaagataagact
ggtggtgatattccaatgccagcctattttagattccttgcgctgctagcattcaagata
ttttctgatgagcaggtggatgtagctgtgcttgaggttggtttgggaggaaaatatgat
gcaacgaacgtggtcaaagcacctgtagtttgtggaatatcttcccttggatatgatcac
atggagattcttggaaatacgctaggagaaattgctggggagaaagccggaatattaaag
aaaggagttccagcatatacagttccacaaccagaagaggcaatgtctgtactgaagcac
agagcttctgaattgggtgttcctcttcaagtagtccagcctttggatccacaacaattg
gatgatcaacctcttgggctacatggtgaacaccaatacatgaatgctggccttgcagtc
gcattggttaatacctggcttcaaaggcaagggcatttcaacatactacataagaagcat
tctgttaccttgccagatcaattcatcgaagggctgtcaagtgcttgtttgcaaggacga
gcacagattgttccagatccggaagtgctgtccaaagacagcagttccttaattttctat
ttggatggagcacatagcccagaaagtatggaaatttgtgcgaagtggttttcctgtgtt
acaagaaaggatgaacaacaaccaggccctttggatcagctacatattggcaccaattct
aggaagattctcctgttcaattgcatgtctgtaagagatcctcaaagactgcttccatgt
cttctagctacatgtgcccagaatggactccagtttgatcatgccctatttgtgccaaat
caatctcaatacaacaagcttggttctcatgcatcaccaccttcagagcgtgtgcaaatc
gatctgtcatggcaattatcacttcaaagagtgtgggaaggcctgcttcatagcaataaa
ggtctaaatggttcaaactccagtacagctagttctgtttttgaatctcttccattggca
atcaaatggctaagggaaactgctcaacaaaaccaatctacttcatatcaggtcttagtt
actggctccctgcatcttgttggtgatgtattgagattgctcaaggagtaa

DBGET integrated database retrieval system