KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331418
Entry
4331418           CDS       T01015                                 
Name
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00650  Butanoate metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4331418
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4331418
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4331418
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     4331418
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C
Other DBs
NCBI-GeneID: 4331418
NCBI-ProteinID: XP_015632268
UniProt: A3ADI5 A0A8J8YRB8
LinkDB
Position
3:1015263..1024672
AA seq 463 aa
MAAERKDVGILAMDIYFPPTCVLQDELENHDGVSKGKYTIGLGQDSMAFCTEVEDVISMS
LTVVKSLLENYKIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNAC
YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPVSF
ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKLEGKQFS
IHDADYFVFHSPYNKLVQKSFARLYYNDFLRKCSTVEDGSREKLEPYSGLSSEESYQSRE
LEKASQQVAKHLYDSKVQPTTLIPKQVGNMYTASLYAALASVMHNKNETLAGQRIVMFSY
GSGLTSTMFSFKINEGQHPFILSNIAGILDVSKKLESRHVVAPEKFVAALKLMEHRYGAK
DFTTSQDTSLLAPGTYYLTHVDSMYRRFYAVKGQAVTEVSNGH
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcggcggagaggaaggacgtgggcattctcgccatggacatctacttcccgcccacc
tgcgtgctccaggacgagctggagaatcatgatggcgtgagcaaagggaagtacaccatt
gggcttggacaggatagcatggccttttgcactgaagtggaagatgttatttccatgagc
ttgacagtagtgaagtcactcctggaaaactataagattgatccaaaatgtattggacgt
ttggaagttggcagtgaaacagtaatagacaagagcaagtctataaaaacatggctgatg
caaatatttgaggaatgcggtaatactgacattgaaggagttgactcctcaaatgcatgc
tacggtggaacagctgctttatttaattgtgttaattgggtcgagagcaactcatgggat
ggacgttatgggcttgttgtttgcacagacagcgcggtttacgctgaaggtccggctcgt
ccaaccggtggtgcagctgctattgcaatgttgattggaccaaatgctccagtttctttc
gaaagcaagtatagaggatctcatatggcacatgtctatgacttttacaagcctgatctt
gctagtgaatacccggtggtcgatggaaagctatcacagacatgctatctcatggcatta
gattcctgctacaatgtcttctgcaaaaagtatgaaaagcttgagggaaagcaattttct
attcatgatgcagactattttgtatttcactccccatacaacaagcttgtgcagaagagc
tttgcacgcctatactacaacgattttctgagaaaatgcagcacggtggaagatggatca
agagaaaaactggagccttattcaggtttgtcatccgaggaaagctaccagagtagagaa
cttgaaaaggcttctcagcaagttgcgaagcacctctatgattcaaaggttcaaccaact
acattaatcccgaaacaagtcgggaatatgtacacagcgtctctatatgctgctttggca
tcagtgatgcataacaaaaatgaaactctggcaggccaaaggattgtcatgttctcatac
ggcagtggcttgacatcaacaatgttctctttcaagatcaatgaaggccagcatccattc
atcctatcaaacattgcaggcatactggatgtctccaagaaactggagtccaggcatgtg
gttgcgccggagaagttcgtggcggcgctgaagctgatggagcaccggtacggcgccaag
gatttcacgacgagccaggacacgagcctgctcgctccaggcacctactacctcacccac
gtcgactccatgtacaggaggttctacgccgtcaaaggtcaagccgtcaccgaagtgtcc
aatggccattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346215
Entry
4346215           CDS       T01015                                 
Name
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00650  Butanoate metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4346215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4346215
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4346215
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     4346215
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C DNAP_B_exo_N
Other DBs
NCBI-GeneID: 4346215
NCBI-ProteinID: XP_015650115
UniProt: Q0J3Z1 Q6ZBH5
LinkDB
Position
8:27302238..27306854
AA seq 467 aa
MEQPNDVGILAMDIYFPPACVHQEALEAHDGASKGKYTIGLGQDCMAYCSEVEDVISMSL
TVVASLLKKYNIDPKQIGRLEVGSETVIDKSKSIKTWLMHIFEESGNTDIEGVDSSNACY
GGTAALLNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFE
SKYRASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQYCTKYEKIVGEQFSI
SDAEYCVFHSPYNKLVQKSFARLYFNDFMRNCSTVDNDAKEKLQPFANLTSEESYQSRDL
EKASQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVIYNKHDSLDGQRILMFSYG
SGLTSTMFSLRLHDGQHPFSLMNIASVLDVTTKLESRHVTSPEKFIETLKLMEHRYGAKD
FETSKDTSLLPPGTFYLTKVDSMYRRFYDKKAAEGKIKGCNGIANGH
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggagcagcccaacgacgtcgggatcctcgccatggacatctacttccctcccgcctgc
gtccaccaggaagcgctggaagcgcacgatggagccagcaagggtaagtacacaattggt
cttgggcaggactgcatggcctattgcagcgaggtggaagatgttatctctatgagcttg
acggttgttgcatcactgctgaaaaagtacaacattgatcctaagcaaattggccgcctg
gaggttggtagtgagacagtgatagacaaaagcaaatccatcaaaacatggctgatgcat
attttcgaggagagtggcaatactgacattgagggggttgactcaagtaacgcatgctat
ggtggaacagctgccctgttgaattgtgttaattgggtggaaagtaaatcctgggatgga
cgctacggtcttgttgtttgcacagatagcgcggtttatgcagaagggccagctcgtcca
acaggtggtgctgctgctattgctatgcttattggtccgaatgctcccatttcttttgaa
agtaaatatagggcttcacacatggcccatgtttacgatttctacaagcctgatcttgca
agtgaatacccggttgttgatggaaaactttctcagacatgctatctgatggctcttgat
tcgtgctataggcaatattgtaccaagtatgaaaagatagtgggagaacaattctcgatt
tctgatgcagaatactgtgtcttccattctccatataataagcttgtacaaaagagtttc
gcccgactttatttcaatgacttcatgcgtaattgcagcacggttgataatgatgctaaa
gagaagcttcagccttttgcaaatttgactagtgaagaaagctaccaaagtcgtgacttg
gaaaaggcctctcaacaagtagcaaagcatctgtatgatatcaaagttcaaccatcaact
ctgcttccaaaacagatcggtaatatgtacactgcatctctttatgctgcattggcatct
gtgatctacaacaagcatgacagtctggatggccagcgaattctcatgttttcttatggg
agtggattgacatccactatgttttcgttgagactacatgatggtcaacatccctttagc
ttaatgaacattgcttctgtgcttgatgtgacgacaaagcttgagtcaagacatgtgacc
tcacctgagaagtttattgagacattgaagctgatggagcaccgctatggagcaaaagat
tttgaaacaagcaaagataccagcttgttgccaccaggaacattctatcttacaaaagtt
gattcgatgtacaggaggttctatgacaagaaagccgccgagggaaaaatcaagggctgc
aacggcattgcaaacggtcactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347614
Entry
4347614           CDS       T01015                                 
Name
(RefSeq) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00650  Butanoate metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4347614
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4347614
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4347614
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     4347614
SSDB
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C
Other DBs
NCBI-GeneID: 4347614
NCBI-ProteinID: XP_015612633
UniProt: Q0J095
LinkDB
Position
9:20367323..20371154
AA seq 476 aa
MDGRKDVGILAMDIYFPPTCVLQESLEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSM
TVVTSLLKKYKVDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACY
GGTAALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIAFE
SKYKASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCKKYEKLAGKQFSI
SDADYFVFHSPYNKLVQKSFARLYYNDFTRDCSSVDNDAKEKLQPFSNLTGEESYQSRDL
EKASQQVAKPLYDIKVQPSTLLPKQIGNMYTASLYAALASVLYNKHASLDDQRIVMFSYG
SGLTSTMFSLKLNNGQDPFSLSNIASVLNATEKLESRHMTLPEKFVETLKLMEHRYGAKD
FETCKDTSLLPPGTFYLTRVDSMYRRFYERKADEEIAAAKAKYSNGHATNGYANGH
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggacggccgcaaggatgtcgggatcctcgccatggatatctacttcccgcccacctgc
gtcctccaggaatcgctcgaggctcatgacggcgccagcaaagggaagtacaccattggt
ctcggccaagattgcatggccttctgcagtgaggtggaggatgtcatctcgatgagcatg
acagttgtcacatccctgctgaaaaaatacaaggtcgatccaaagctgattggtcgattg
gaggttggcagtgagacagtcatagacaagagcaaatccatcaagacttggctgatgcag
attttcgaggaatgcggtaatactgacattgaaggagttgattccagtaacgcgtgttat
ggtgggacagcagcgctgttgaattgtgtgaactgggttgagagtaactcctgggatgga
cgctatggccttgttgtttgcacggacagcgcggtttatgcggaaggcccagctcgtccg
acaggtggtgctgctgctattgcaatgctcattggtcctaatgctcctattgcattcgag
agcaaatacaaagcttctcacatggctcacgtctatgatttctataagcctgatcttgca
agtgaatatccggtcgttgatggaaaactatcccaaacatgctacttgatggcgctagac
tcatgctacagacagttttgtaagaagtatgaaaagctggcggggaaacaattctcaatt
tctgatgcagattactttgttttccattctccatacaacaagcttgtgcagaagagtttt
gctcggctttactataatgatttcacgcgcgactgcagctctgttgacaatgatgctaaa
gagaagctccagcctttctcaaatttgactggcgaggagagctaccaaagtcgtgacttg
gaaaaggcttcacaacaagtagcaaagcccttgtatgacatcaaagttcaaccatcaact
ttgcttccaaaacaaattggtaacatgtacacagcatctctttatgctgcgttggcgtct
gtactctataacaagcatgctagtctggatgaccaacgaattgttatgttctcgtacggc
agtggcttgacatccactatgttttcgttgaaacttaacaatggccaggaccccttcagt
ttatcaaacattgcttcagtgcttaatgccacggagaagcttgagtcaagacatatgacc
ttgcccgagaaatttgtggagacgctgaagctgatggagcaccgatacggcgcaaaagat
ttcgagacgtgcaaagacacgagcttgttgcctcctgggacgttctacctcaccagggtt
gactccatgtaccgaagattctatgagaggaaggccgacgaggagatcgctgcagccaaa
gccaagtacagtaatggacatgccaccaatggctatgccaatggccactag

DBGET integrated database retrieval system