KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331442
Entry
4331442           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331442
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331442
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4331442
  Bacteria
    4331442
  Archaea
    4331442
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Other DBs
NCBI-GeneID: 4331442
NCBI-ProteinID: XP_015628889
UniProt: B9FAJ0 Q9AYT6
LinkDB
Position
3:complement(1232240..1234463)
AA seq 210 aa
MATTSLSLHGVPSPTATKLSSSFLGAPASFLRPTPPPLAAPSRRALAVRAMAPPKPGGKP
KKVVGLIKLALEAGKATPAPPVGPALGAKGVNIMSFCKEYNAKTAEKAGYIIPVEITVFD
DKSFTFILKTPPASVLLLKAAGIEKGSKEPQREKVGKVTADQVRTIAQEKLPDLNCKSID
SAMRIIAGTAANMGIEVDPPILEKKEKVLL
NT seq 633 nt   +upstreamnt  +downstreamnt
atggccaccacctccttgtccctgcatggcgtcccatcccccaccgccaccaagctctcc
tcctcctttctcggcgcccccgcctccttcctccggccgacgccgccgccgctcgctgcc
ccctcgcggagggcgctcgccgtcagggccatggcgccacccaagcccgggggcaagccc
aagaaagtggtgggcctcataaagctggcgctggaggccgggaaggccacgccggcgccg
ccggtcggccccgcgcttggtgccaagggtgtgaacatcatgtccttctgcaaggagtac
aatgccaagacggccgagaaggccggctacatcatccctgtcgagatcaccgtgttcgat
gataaaagtttcacctttatcttgaagacccctcctgcctcagtccttctcctcaaggca
gcaggtatcgagaaaggttcaaaagaaccgcagcgagagaaggttggaaaagtaacagca
gatcaagtacgtacaatagctcaagagaagttgccagatttgaactgcaagagcattgac
tcggccatgagaattatagcgggcactgctgctaatatgggaatcgaggttgaccctcca
atacttgagaagaaggaaaaggtgctcttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348843
Entry
4348843           CDS       T01015                                 
Name
(RefSeq) 54S ribosomal protein L19, mitochondrial
  KO
K02867  large subunit ribosomal protein L11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348843
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348843
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4348843
  Bacteria
    4348843
  Archaea
    4348843
SSDB
Motif
Pfam: Ribosomal_L11 Ribosomal_L11_N
Other DBs
NCBI-GeneID: 4348843
NCBI-ProteinID: XP_015613037
UniProt: Q9AV82 A3C5K3
LinkDB
Position
10:complement(17201439..17203147)
AA seq 155 aa
MATTLKDAVARKPVLATIRLIVPAGAARPAPPVGPALGFYRLNLMAFCKDFNARTQKYKA
ETPMQVTLTAYKDSTFEFVVKSPSVSWFLKKAAGIETASGRPGHTVVSSLSLRHVYEIAK
LKQSDPYCKHMSLEALCKSIIGTANSMGIEIVKDL
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcaaccactctgaaagatgcagttgcacggaagcctgtgttggcaacaatccgcctt
atcgttccagctggtgccgcccgccctgcgccaccagttggtccagcgctaggtttctac
aggctgaacctgatggcgttctgcaaggatttcaatgccaggactcagaagtataaggca
gaaactcctatgcaggttaccttaactgcctacaaggacagcacattcgagtttgtagtc
aagtcaccatctgtctcatggttcctcaagaaggccgccgggattgagacagccagcggc
cgtccagggcacactgtagtgtcatccctttcacttcgccatgtctacgagatcgcgaaa
ttgaagcaatctgatccctactgcaagcacatgtcactcgaggcgctgtgcaagtcaatc
attggcacagccaactccatgggcattgagattgttaaagatctatga

DBGET integrated database retrieval system