KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331446
Entry
4331446           CDS       T01015                                 
Name
(RefSeq) SUMO-conjugating enzyme SCE1
  KO
K10577  ubiquitin-conjugating enzyme E2 I
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    4331446
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4331446
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4331446
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   4331446
SSDB
Motif
Pfam: UQ_con Prok-E2_B
Other DBs
NCBI-GeneID: 4331446
NCBI-ProteinID: XP_015632200
UniProt: A3ADM0 Q8H8G9
LinkDB
Position
3:1318227..1321549
AA seq 160 aa
MSGGIARGRLAEERKAWRKNHPHGFVAKPETLADGTVNLMIWHCTIPGKQGTDWEGGYFP
LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
LDQPNPADPAQTDGYHLFIQDPTEYKRRVRLQAKQYPPIV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtcggggggaatcgcgcgcggccgcctcgcggaggagcggaaggcgtggcggaagaac
cacccacacggtttcgtcgccaagccggagacgttggccgacgggacggtcaacctcatg
atctggcactgcacaatccccggcaagcaagggactgattgggaaggtggatactttcct
ctcactcttcatttcagtgaggattaccctagcaaacctcccaagtgcaagttcccacag
ggtttcttccacccaaatgtctatccttcagggacagtctgcctttcaattcttaatgaa
gacagcggttggagacctgctattaccgtcaagcaaattcttgttggaatccaggacttg
cttgatcagcctaatcctgctgatcctgctcagaccgatggttaccatctttttatccag
gatcctacggaatacaagaggcgtgttcggctgcaggccaagcagtatcctccgattgtc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336760
Entry
4336760           CDS       T01015                                 
Name
(RefSeq) SUMO-conjugating enzyme SCE1
  KO
K10577  ubiquitin-conjugating enzyme E2 I
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    4336760
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4336760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4336760
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   4336760
SSDB
Motif
Pfam: UQ_con Oxidored-like
Other DBs
NCBI-GeneID: 4336760
NCBI-ProteinID: XP_015634605
UniProt: Q7X8X5
LinkDB
Position
4:complement(29289184..29292323)
AA seq 160 aa
MASGGGIARARLAEERKAWRKNHPHGFVAKPETLPDGSVNLMVWRCIIPGKEGTDWEGGY
FPLTMQFTEDYPTNAPSCKFPSGFFHINVYDSGAVCLSILSTAWKPSITVRQILIGIQEL
FDDPNPNSAAQNISYELYRKDMEEYRKRVRQQAKKYPSAL
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcatccggaggaggcatcgcccgcgcccgcctcgccgaggagcgcaaggcgtggcgc
aagaaccacccccatggcttcgtggccaagccggagaccctgccggatgggtccgtcaac
ctcatggtctggcgatgcatcatccccggcaaagaagggactgattgggagggtggatat
ttcccacttactatgcaattcactgaagactatccaaccaacgctccttcttgcaagttc
ccatcgggtttcttccacatcaatgtctatgactctggggcagtatgcctatcaatcttg
agtaccgcatggaaaccttcaattacagtgaggcaaattcttataggcatccaggaattg
tttgatgatccaaaccctaactctgctgcacagaatataagctatgagctttataggaag
gacatggaggagtacaggaaacgcgttcgtcagcaggctaagaagtatccttcagctctg
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349236
Entry
4349236           CDS       T01015                                 
Name
(RefSeq) SUMO-conjugating enzyme SCE1
  KO
K10577  ubiquitin-conjugating enzyme E2 I
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    4349236
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4349236
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4349236
Ubiquitin system [BR:osa04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   4349236
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 4349236
NCBI-ProteinID: XP_015614559
UniProt: B9G6S0 Q8W2X7
LinkDB
Position
10:complement(20847951..20851314)
AA seq 160 aa
MSGGIARGRLAEERKAWRKNHPHGFVAKPETMADGSANLMIWHCTIPGKQGTDWEGGYYP
LTLHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDL
LDQPNPADPAQTDGYHIFIQDKPEYKRRVRVQAKQYPALL
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtcgggagggatcgcacgcggccgcctcgcggaggagcgcaaggcctggcggaagaac
caccctcacgggttcgtggcgaagccggagacgatggccgacgggtcggcgaacctcatg
atctggcactgcaccatccccggcaagcaggggaccgattgggaaggtgggtactaccct
cttacccttcacttcagtgaggactatcctagcaaaccacccaagtgcaagttcccacag
ggctttttccacccaaatgtctatccttcaggaacagtgtgcctctcaattcttaatgag
gatagtggctggagacctgctatcactgtaaagcagatccttgttggaatacaggacttg
cttgatcagccaaatcctgctgatcctgcacagactgacggttatcacatttttatacag
gacaaaccagaatataagaggcgtgttcgtgttcaggccaagcagtaccctgctttgctt
tga

DBGET integrated database retrieval system