KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331468
Entry
4331468           CDS       T01015                                 
Name
(RefSeq) anthranilate phosphoribosyltransferase, chloroplastic isoform X1
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4331468
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     4331468
SSDB
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Other DBs
NCBI-GeneID: 4331468
NCBI-ProteinID: XP_015630986
LinkDB
Position
3:complement(1486004..1490682)
AA seq 399 aa
MAAASIKLSSSAKPLAPAPVSHLLPLRAHHARPLPARLPPPPRVAVQHTAARASDASPRT
ASFDKVLETLIGGDHFSEEEAEATLRLLLEEENEARIAAFLVLLRAKGETYEEIVGLAKA
MIGCCVRVDGLDDAVDIVGTGGDGADTVNISTGSTILAAAAGAKVAKQGSRASSSACGSA
DVLEAFGVNIELGPEGIKRCVNEVGVGFMMSANYHPAMKIVKPVRKKLKIKTVFNILGPL
LNPARVPYAVIGVYHENIVTKMAKAAQKFGMKRALVVHSKGLDEISPLGPGYILDVTPRK
IEKMLFDPLDFGIPRCTLEDLKGGDPAFNAKVLQDVLAGQRGSIADALVLNAAASLLVSG
KVNTLHDGVALAQETQRSGEAINTLESWIKISNVSTSDN
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggcggcgtcgatcaagctctcctcctccgccaagcccctcgcccccgcgccggtc
tcccacctcctccccctccgcgcgcaccacgcgcggccgctccccgcgcgcctcccgccg
ccgccccgcgtcgccgtgcaacacaccgccgcgcgggcctccgatgcctccccccgcacc
gcctccttcgacaaggtgctggagacgctgatcggcggtgaccacttctcggaggaggag
gcggaggcgacgctgcggctgctgctggaggaggagaacgaggcgcgcatcgccgccttc
ctcgtgctcctcagggccaagggcgagacctacgaagagatcgtggggttggcgaaggcg
atgataggctgctgcgtccgggtcgacgggctcgatgacgccgtcgacattgtcggcacc
ggcggggacggcgcggacaccgtcaacatctccaccggctccaccatcctcgccgccgcg
gcgggtgccaaagtcgccaagcaagggagcagagctagctcgtcggcctgcggcagcgcc
gatgtgctggaggcgtttggtgtcaacatcgagttgggacccgagggtattaaacgatgt
gtcaatgaggtgggtgttggattcatgatgtctgcaaactatcatccagcaatgaaaatc
gtgaaacctgtgaggaagaagctgaaaataaagacagttttcaatatccttggtcctctc
ttaaatccagcaagggtgccttatgctgttattggtgtttaccacgagaacatagttacc
aagatggctaaggcagctcagaaatttggaatgaagagagcattggttgtccattcgaag
ggtttggatgaaataagcccacttgggcctggatatatccttgatgtcacaccaagaaag
attgaaaaaatgctcttcgatccattggattttggtataccccgctgcacgctggaagat
ctaaaaggaggtgatccagcgttcaacgcaaaagttctccaggatgttcttgctggtcaa
agaggttcaattgctgatgctctcgtgctgaatgctgcagcatctcttcttgtcagtggt
aaagtaaatactttgcatgatggtgtagcgttagcacaggaaacacaacgctccggggag
gccatcaacacacttgaatcctggataaagatttccaatgtaagtacttctgataattaa

DBGET integrated database retrieval system