KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331494
Entry
4331494           CDS       T01015                                 
Name
(RefSeq) exosome complex exonuclease RRP44 homolog A
  KO
K12585  exosome complex exonuclease DIS3/RRP44 [EC:3.1.13.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4331494
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4331494
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-
     4331494
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     4331494
SSDB
Motif
Pfam: RNB OB_Dis3 Rrp44_CSD1 PIN_4 Rrp44_S1 CSD2 OB_RNB
Other DBs
NCBI-GeneID: 4331494
NCBI-ProteinID: XP_015630807
LinkDB
Position
3:complement(1653193..1661562)
AA seq 934 aa
MLQSKTFVKKTRAGRVQKVVREHYLRDDISCGAASCSTCGAVEHPLSADAAAILVVDTNV
VLHQIDLLENPAIDDVVLLSVVLDEVKNKNLAVFNRIKALCSNKARRFFVFTNEHHRDTY
VKEMVGESPNDRNDRAIRVATRWYQSHLGENVKVLLITNDRDNKRKAIEEGINAETVESY
VRSLAQPGLLDLVVVSTSGDVTMEDVEDLRPSKKKVIYSEHKPMSEITAGLRCGIYHQGK
LRVNRYNPFEAYVGSESIGDEIVIHGRSNMNRAFDGDIVAVELLPQDQWHESKSFIADDD
EDDEEDVHLAPNSADDAPRKANPTQSTAASSADSVSSRPVGRVVGIIKRNWNSYCGSLEP
MPMPAGSGGVAHALFVSKDRRIPKIRIQTRQLGNLLDKRIIVAVDSWDVLSRYPSGHYVR
TIGDIGDKDTETEVVLIENDINTRPFSTQVLACLPPLPWTLSPEDLANPNRQDLRHVRVF
SVDPPGCRDIDDALHCTPLPNGNFEVGVHIADVTNFVHPGTPLDEEASQRGTSVYLVGQR
IDMLPKPLTEDVCSLRADVERLAFSVIWEMTPHADIISTRYTKSVIKSCAAMSYVEAQAR
MDDSRLVDPLTVDLRNLNSLAKIMRHRRCERGALTLASAEVKFEIDSETHDPLDIGIYQI
REANQMIEEFMLAANISVAEKILKHFPLCSLLRRHPSPTKEMLEPLLRTASSVGLNLDVS
SSKALAESLDNAKNDDPYFNKLIRILATRCMTQAVYFCSGDLTFSEYYHYGLAASLYTHF
TSPIRRYADVIVHRLLAAALEIAKLPPLFQDGPQLTGVADNLNYRHRNAQMASRASVELH
TLIYFRTRRMDTEARIVKIKANGFIVFVPKFGIEGPIYLTPKGDKGGDWVVDEVHQRVTK
PGTNVSYAVLQTVMIHMEVVEPQPHRPKLQLTLI
NT seq 2805 nt   +upstreamnt  +downstreamnt
atgttgcagagcaagaccttcgtgaagaagacgagggcaggccgcgtccagaaggtggtc
agggagcactacctccgcgacgacatctcctgcggcgccgcctcctgctccacctgtggc
gcggtcgagcacccgctctccgccgacgcggccgccatcctcgtcgtcgacaccaacgtc
gtgctccaccagatcgatttgctggagaatccagcgattgacgatgttgtcctactatcg
gttgtgttggatgaggtgaagaataaaaacctcgcagtgttcaacaggatcaaggccctg
tgttctaacaaggcaaggaggttcttcgtgttcaccaatgagcaccacagggatacatat
gtcaaagagatggttggagagagcccgaatgatcgcaacgatagagctattcgtgtggct
actcgttggtaccaaagtcatcttggtgagaatgtgaaagttttgctgatcacaaatgat
agagataacaaacggaaagctattgaagaaggcattaatgctgagacagtggaatcatat
gtacgatctcttgcacagcctggtttgctcgatttagtggttgtttcaactagtggagat
gtcacaatggaagatgtagaagatcttagaccgtccaaaaagaaagtaatttacagtgag
cacaaacctatgtcagaaattacagctggcctgcggtgtggaatttatcatcaagggaag
ctccgagttaatcgttacaatccatttgaagcttacgttggaagtgagagcattggtgat
gagattgttattcatggccgttcaaacatgaatagggcttttgatggagacatagttgct
gttgagctcttgccacaagatcaatggcatgaatcgaagtcatttattgcagacgacgat
gaagatgatgaagaagacgtccatttggctccaaatagtgctgatgatgctccacggaaa
gccaatcccacacaatcaacagctgcatcatcagctgattctgtctctagtcgcccagtt
ggacgtgttgttggtataatcaagcgaaattggaattcgtattgtgggtccttggagcca
atgcccatgcctgctggtagtggaggcgttgctcatgctctatttgtgtctaaagatcga
cgaatcccaaagattcgaattcaaactagacagcttggcaatcttctggacaaaaggatt
attgttgcagttgattcatgggatgtcttgtctcgatacccatcaggacattatgtacgg
actataggagatattggtgacaaagatactgaaacagaggttgtcttaatagagaatgat
atcaacacaagacctttctctacacaagtccttgcttgtttgccaccattgccatggaca
ttatcacctgaagatcttgctaatcctaatagacaagatttacgccatgtgagagtcttt
agtgtggatccgcctggttgtagggatattgatgatgcgctacattgcacgccactccca
aatgggaattttgaagttggagttcatattgctgacgtcactaactttgttcatcctggt
actcctcttgatgaggaggcctcacaaaggggcacttctgtatatcttgttggacagcga
attgacatgcttccaaagcctcttactgaagatgtttgttctcttcgtgctgatgttgag
agattggcgttctctgtcatttgggaaatgacacctcatgctgatatcatatccacaaga
tatacaaagagtgttatcaagtcttgcgctgcaatgtcttatgtggaagctcaagcaaga
atggatgacagccgtttggtcgatcccctaactgtagacctgcggaacttaaactcgtta
gcaaagattatgaggcatcggcgttgtgaaagaggggctctaacacttgcttcagcagaa
gtcaaattcgaaattgatagtgaaacccatgatccgcttgacataggaatatatcaaatt
cgtgaggcaaatcaaatgattgaagagtttatgttggctgcaaatatctctgtcgctgag
aagattttgaagcacttccccttgtgttcattgctaaggcgccatcctagcccaacaaag
gagatgcttgagccattactccgaactgcgtcttctgtggggctaaatctggatgtgtca
tcctcaaaagcattagcagaatcacttgataatgcaaagaatgatgacccatacttcaac
aagcttatcaggattttggcaactagatgcatgacacaggcagtttatttctgtagcgga
gacttgaccttttctgagtattaccattatggccttgctgcttctctttacacacatttc
acctcccctattcgcagatatgcagatgttattgttcataggttgttagctgctgcccta
gaaattgccaaacttccacccctctttcaggatggtccacaacttacaggcgtagctgac
aacttgaattatagacatcgaaatgcccagatggcaagcagagcatcagttgagcttcat
accctcatatatttcaggacaaggcggatggacactgaagctagaattgtaaagatcaag
gcaaatggtttcatagtatttgtcccaaagtttggcatagaagggcccatctaccttact
ccaaagggagacaaggggggtgattgggtagtagatgaggtgcaccagagagtaaccaag
cccgggacaaacgtcagttacgctgtcctgcagaccgttatgattcatatggaggtggtt
gagcctcagcctcaccgcccaaagttgcaactcaccctgatatga

DBGET integrated database retrieval system